LXL04_017618 | RubberDandelionOmics

Gene overview

LXL04_017618

Reference: OH-1004 Chr: Chr03 Coordinates: 155262982-155264338 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1134 bp · LXL04_017618|LXL04_017618|OH1004|cDNA

ATGCATAATGAAAGGTTGGGAGAAGGACATGTTCTTCAACAAAAATCTCTCATAACCATTGATGATAATAAACGTGTAGGCATGCATGACCATATTGAAGAAATGGGTAGGAATATTGTTCGTCGTCCGCACCATAACAGACCTCGTAAACACAGTCGATTGTGGAAAGAAAACGAAATTAAACATATATTGACTAATCAACTGGGTACTGAAGAAACAAGATGTATATGTTTCAATGCTATGAATCTCAATACATCTAC...

CDS

Download CDS FASTA

1134 bp · LXL04_017618|LXL04_017618|OH1004|CDS

ATGCATAATGAAAGGTTGGGAGAAGGACATGTTCTTCAACAAAAATCTCTCATAACCATTGATGATAATAAACGTGTAGGCATGCATGACCATATTGAAGAAATGGGTAGGAATATTGTTCGTCGTCCGCACCATAACAGACCTCGTAAACACAGTCGATTGTGGAAAGAAAACGAAATTAAACATATATTGACTAATCAACTGGGTACTGAAGAAACAAGATGTATATGTTTCAATGCTATGAATCTCAATACATCTAC...

Protein

Download Protein FASTA

377 aa · LXL04_017618|LXL04_017618|OH1004|PROTEIN

MHNERLGEGHVLQQKSLITIDDNKRVGMHDHIEEMGRNIVRRPHHNRPRKHSRLWKENEIKHILTNQLGTEETRCICFNAMNLNTSTVMKGIGMMKSLRFLYVVLRTSYGRGGLYTFIPSFPDALGFLRVVYYPFKYLPKTFQGNNLVTLEIPFSAVQQLWEGGEHKVLDKLRFLDFSNSRHMKLDPQLTPNLEIINLSGCHGLLGGMWTLKHLISLDLHGSRLRNLPEDIGRSRCLENLSLSNTNITHLPDSICMLRHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017618`
TK1151 ID	TkA02G025520
OH-1004 ID	LXL04_017618
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.800
Protein coverage (%)	TK1151 45.973 / OH-1004 36.340 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017618

Location Chr03:155262982-155264338 (-)

Description Similar to RPV1: Disease resistance protein RPV1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12020`	Transcription factor.	No verified direct reference in this release
`At4g19510`	Disease resistance protein that cooperates with RPP2A to confer resistance to Hyaloperonospora parasitica isolate Cala2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017618 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1902065 response to L-glutamate Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT4G12020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.531

Rank 1 · LXL04_017618 · OH-1004

Cytoplasm0.318

Rank 2 · LXL04_017618 · OH-1004

Cell membrane0.140

Rank 3 · LXL04_017618 · OH-1004

Endoplasmic reticulum0.079

Rank 4 · LXL04_017618 · OH-1004

Extracellular0.044

Rank 5 · LXL04_017618 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23282.2WHD_ROQ111-41 aa

PF23598.2LRR_14191-289 aa

PF13855.13LRR_8213-268 aa

PF25019.1LRR_R13L1-DRL21234-290 aa

PF23598.2LRR_14254-316 aa

PF23598.2LRR_14299-355 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017618	`PF23282.2`	WHD_ROQ1	11	41	4.5e-08	33.8
LXL04_017618	`PF23598.2`	LRR_14	191	289	8.6e-28	97.8
LXL04_017618	`PF13855.13`	LRR_8	213	268	5.1e-10	39.7
LXL04_017618	`PF25019.1`	LRR_R13L1-DRL21	234	290	5.5e-08	33.5
LXL04_017618	`PF23598.2`	LRR_14	254	316	8.6e-28	97.8
LXL04_017618	`PF23598.2`	LRR_14	299	355	8.6e-28	97.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ67`	Arabidopsis thaliana	Probable WRKY transcription factor 19	34.066%	Swiss-Prot	moderate database homology
`F4JT80`	Arabidopsis thaliana	Disease resistance protein RPP2B	32.065%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card