LXL04_017601 | RubberDandelionOmics

Gene overview

LXL04_017601

Reference: OH-1004 Chr: Chr03 Coordinates: 155037807-155040353 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1527 bp · LXL04_017601|LXL04_017601|OH1004|cDNA

ATGTTGCTTAAGCTTATCCACAATTCGAATAGAAAAACCACTTCGGAATTTTTTTCATCAATGAGGAAATATATCTCCACTTCCAGACATTCTGCAGTTGATTTGGCTTCCAAAGATGGAGAAATGAGGATATTTCTAGTTGCAGGAGAAGCTTCAGGAGATGCAATTGGTTCTCGTTTAATAGCTGCTTTAAAGAAGTTCTCACCATTCCCAATACATGTTGCCGGAGTTGGAGGATCATTGATGGCAAAACATGGATT...

CDS

Download CDS FASTA

1527 bp · LXL04_017601|LXL04_017601|OH1004|CDS

ATGTTGCTTAAGCTTATCCACAATTCGAATAGAAAAACCACTTCGGAATTTTTTTCATCAATGAGGAAATATATCTCCACTTCCAGACATTCTGCAGTTGATTTGGCTTCCAAAGATGGAGAAATGAGGATATTTCTAGTTGCAGGAGAAGCTTCAGGAGATGCAATTGGTTCTCGTTTAATAGCTGCTTTAAAGAAGTTCTCACCATTCCCAATACATGTTGCCGGAGTTGGAGGATCATTGATGGCAAAACATGGATT...

Protein

Download Protein FASTA

508 aa · LXL04_017601|LXL04_017601|OH1004|PROTEIN

MLLKLIHNSNRKTTSEFFSSMRKYISTSRHSAVDLASKDGEMRIFLVAGEASGDAIGSRLIAALKKFSPFPIHVAGVGGSLMAKHGLKSVFPMEDIAVMGIWELLPHLTKFQVRLNQTFEAAIAFNPHVIITIDSKGFSFRLLKQLRAKYGQKGPLHFHYVAPSFWAWKGGESRLKGLSEFIDHILCILPFEEEVCRYNGVPATFVGHPVLEDTLEMNSVQGNADLFRGKYGISSGSIVFSLLPGSRLQEVTRMLPIYSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017601`
TK1151 ID	TkA02G024780
OH-1004 ID	LXL04_017601
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017601

Location Chr03:155037807-155040353 (+)

Description Similar to LPXB: Probable lipid-A-disaccharide synthase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04560`	Condensation of UDP-2,3-diacylglucosamine and 2,3-diacylglucosamine-1-phosphate to form lipid A disaccharide, a precursor of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017601 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009245 lipid A biosynthetic process Biological Process

GO:2001289 lipid X metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005543 phospholipid binding Molecular Function

GO:0008915 lipid-A-disaccharide synthase activity Molecular Function

KEGG gene cross-reference

ath:AT2G04560

gbe:GbCGDNIH1_1441

gox:GOX0260

mag:amb2484

rce:RC1_1194

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.915

Rank 1 · LXL04_017601 · OH-1004

Mitochondrion0.072

Rank 2 · LXL04_017601 · OH-1004

Cytoplasm0.031

Rank 3 · LXL04_017601 · OH-1004

Nucleus0.028

Rank 4 · LXL04_017601 · OH-1004

Cell membrane0.020

Rank 5 · LXL04_017601 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02684.22LpxB44-414 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017601	`PF02684.22`	LpxB	44	414	1.6e-77	261.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IF99`	Arabidopsis thaliana	Probable lipid-A-disaccharide synthase, mitochondrial	56.774%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card