LXL04_017600 | RubberDandelionOmics

Gene overview

LXL04_017600

Reference: OH-1004 Chr: Chr03 Coordinates: 154929246-154931136 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

870 bp · LXL04_017600|LXL04_017600|OH1004|cDNA

ATGACTTCCGCAGTCACTCCGCAGTCCTACTTTTCCGCAGTCAGTAGTGGGATTCAACATAACTTAATTCCTCTTCTTATTATTCCACTTGTAATTTCAACTTTCGACAATTTTAGGGTTTATTCTTTCTCTTTTATACTAGCAGCCAATACTTTTGATTGGATCATATTAACTTCACCAGAAGCAGCTCTCGTGTTTCTTGATGCCTGGAAAGTTGCTGGTTCCCCAAATGTAATAATAACTGTGGTTGGATCTGGTAC...

CDS

Download CDS FASTA

870 bp · LXL04_017600|LXL04_017600|OH1004|CDS

ATGACTTCCGCAGTCACTCCGCAGTCCTACTTTTCCGCAGTCAGTAGTGGGATTCAACATAACTTAATTCCTCTTCTTATTATTCCACTTGTAATTTCAACTTTCGACAATTTTAGGGTTTATTCTTTCTCTTTTATACTAGCAGCCAATACTTTTGATTGGATCATATTAACTTCACCAGAAGCAGCTCTCGTGTTTCTTGATGCCTGGAAAGTTGCTGGTTCCCCAAATGTAATAATAACTGTGGTTGGATCTGGTAC...

Protein

Download Protein FASTA

289 aa · LXL04_017600|LXL04_017600|OH1004|PROTEIN

MTSAVTPQSYFSAVSSGIQHNLIPLLIIPLVISTFDNFRVYSFSFILAANTFDWIILTSPEAALVFLDAWKVAGSPNVIITVVGSGTTTIFNEATSSTNQLIDVAFVPSKSTGKVLASELPKHGNGNCNVLYPASEKASHDRENGFSNRGFHVTRLNTYTTKTVEYVDQMILEQALSSSVVAVASPSAIRAWMNLVSESDRWHGSIACIGITTASAAKKMGLKNVYYLSSPGLQGWVDSIIDALQTKALKENICMESFIE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017600`
TK1151 ID	TkA02G024430
OH-1004 ID	LXL04_017600
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.700
Protein coverage (%)	TK1151 98.718 / OH-1004 79.931 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017600

Location Chr03:154929246-154931136 (-)

Description Similar to UROS: Uroporphyrinogen-III synthase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26540`	Catalyzes cyclization of the linear tetrapyrrole, hydroxymethylbilane, to the macrocyclic uroporphyrinogen III, a precursor of tetrapyrroles such as chlorophyll, heme and phycobilins.	Identification and characterization of the Arabidopsis gene encoding the tetrapyrrole biosynthesis enzyme uroporphyrinogen III synthase.2008 · DOI: 10.1042/bj20070770

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0186100`	Catalyzes cyclization of the linear tetrapyrrole, hydroxymethylbilane, to the macrocyclic uroporphyrinogen III, a precursor of tetrapyrroles such as chlorophyll, heme and phycobilins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017600 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006780 uroporphyrinogen III biosynthetic process Biological Process

GO:0006782 protoporphyrinogen IX biosynthetic process Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004852 uroporphyrinogen-III synthase activity Molecular Function

KEGG gene cross-reference

ath:AT2G26540

dosa:Os03g0186100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.522

Rank 1 · LXL04_017600 · OH-1004

Nucleus0.268

Rank 2 · LXL04_017600 · OH-1004

Mitochondrion0.132

Rank 3 · LXL04_017600 · OH-1004

Plastid0.110

Rank 4 · LXL04_017600 · OH-1004

Peroxisome0.104

Rank 5 · LXL04_017600 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02602.21HEM447-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017600	`PF02602.21`	HEM4	47	237	7.6e-33	114.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48721`	Arabidopsis thaliana	Uroporphyrinogen-III synthase, chloroplastic	52.720%	Swiss-Prot	strong database homology
`Q10QR9`	Oryza sativa subsp. japonica	Uroporphyrinogen-III synthase, chloroplastic	56.388%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card