Gene Card
Gene overview
cDNA / CDS / Protein Sequences
894 bp · LXL04_017565|LXL04_017565|OH1004|cDNA
ATGGAGAAGTTGCCTGAAACGCTATATGTCGATCCAGCCACCGGTCGATCTTCTTCCGCCGCCGGAGCAAAATCTGCAGCCAGGATAGAGCAGTGCATAGAATTGCTGCACCTGCCTTTGCAGAGAGAAGAAGCCCTTGCTCTGCTAAAcaggGAAcgaaaaaataaagaaatggcAGTGCAAATATGGAATTCTAAGAGTGTCTGCTTCTTCCTCCTACAGGAATTTTGCATGGCTTACAAGTTGTTGTCACCTCCTGC...
894 bp · LXL04_017565|LXL04_017565|OH1004|CDS
ATGGAGAAGTTGCCTGAAACGCTATATGTCGATCCAGCCACCGGTCGATCTTCTTCCGCCGCCGGAGCAAAATCTGCAGCCAGGATAGAGCAGTGCATAGAATTGCTGCACCTGCCTTTGCAGAGAGAAGAAGCCCTTGCTCTGCTAAACAGGGAACGAAAAAATAAAGAAATGGCAGTGCAAATATGGAATTCTAAGAGTGTCTGCTTCTTCCTCCTACAGGAATTTTGCATGGCTTACAAGTTGTTGTCACCTCCTGC...
Protein
Download Protein FASTA297 aa · LXL04_017565|LXL04_017565|OH1004|PROTEIN
MEKLPETLYVDPATGRSSSAAGAKSAARIEQCIELLHLPLQREEALALLNRERKNKEMAVQIWNSKSVCFFLLQEFCMAYKLLSPPALNMKEATRVCNAVALLQSMASHPDTKMGIVRAKMPVFIYPFMNTTEQRLKHFDYLRLTSLGVIGALVKVEDANSPEIVHFLLETEVIPLCLRCIEVGGELAKTVAAFVISKILMYEEGQRYCGTFPERFYAVAQVLITTVDQFTGKPPLQLLKHVLHCFLRLSEVSRPCDALV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_017565 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_017565 |
|---|---|
| Location | Chr03:153545151-153551993 (+) |
| Description | Similar to cnot9: CCR4-NOT transcription complex subunit 9 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006402 mRNA catabolic process Biological Process GO:0006417 regulation of translation Biological Process GO:0017148 negative regulation of translation Biological Process GO:0019221 cytokine-mediated signaling pathway Biological Process GO:0030154 cell differentiation Biological Process GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process GO:0033138 positive regulation of peptidyl-serine phosphorylation Biological Process GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway Biological Process GO:0045742 positive regulation of epidermal growth factor receptor signaling pathway Biological Process |
| KEGG gene cross-reference | dre:406632 mmu:58184 rno:301513 spo:2542094 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04078.20Rcd136-293 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_017565 | PF04078.20 | Rcd1 | 36 | 293 | 6.1e-80 | 269.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.