LXL04_017543 | RubberDandelionOmics

Gene overview

LXL04_017543

Reference: OH-1004 Chr: Chr03 Coordinates: 152879504-152883854 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1248 bp · LXL04_017543|LXL04_017543|OH1004|cDNA

tttttattttcaagaTGTTTAATTATAAAGCAAAAAGCAACCACGATCATTGGGCCCATCCCAGCCTTTCCTCCCATTTTAAATACCATTATACCACCATTCACGCTCCATTATTCCACCAAACCTTCAACATCTTCCCACCACAGAAAAAAACACAGAAAAGAGCGCAGGCCGATGGGCGGCGACGGCGGAGTAGCGCTGCCGACGGTGGTAGAGAGCCGAGAATGGTACTTAGCAGCCTACGCACCGGAAAATGTACC...

CDS

Download CDS FASTA

1074 bp · LXL04_017543|LXL04_017543|OH1004|CDS

ATGGGCGGCGACGGCGGAGTAGCGCTGCCGACGGTGGTAGAGAGCCGAGAATGGTACTTAGCAGCCTACGCACCGGAAAATGTACCGACTTCAGACCATCTAAAGCTCCGTTCAGTCACCGTTTCTTTGGAGTATGATTCCATCGCCGATCAACACGTGGCACTTCAGCTGCTCATGATCTCCGTCGATCCGTATCTACGCTCCACCATCACCGGCCGTGATGGTGATCTGTACTTACCTCGACCTCCCCTCAACAAGGT...

Protein

Download Protein FASTA

357 aa · LXL04_017543|LXL04_017543|OH1004|PROTEIN

MGGDGGVALPTVVESREWYLAAYAPENVPTSDHLKLRSVTVSLEYDSIADQHVALQLLMISVDPYLRSTITGRDGDLYLPRPPLNKVITGFGIGRVVRSKNKNFSEGDIVISPFSPIAEYFIVPSEFLRKIDLTANIPLPNHLSCLGVPGFTAWLAIEVIGNPSTPGSNVFISAAAGGVGMFAGQLAKLKGCRVIGSTGSDEKVQLLKDEFGYDDGFNYHKESDFDAALAKYFPNGIDLYLDNVGGKMLDAVLNHVNTGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017543`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017543

Location Chr03:152879504-152883854 (+)

Description Similar to DBR: 2-alkenal reductase (NADP(+)-dependent)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16970`	Involved in the detoxification of reactive carbonyls.	Protection against photooxidative injury of tobacco leaves by 2-alkenal reductase. Detoxication of lipid peroxide-derived reactive carbonyls.2005 · DOI: 10.1104/pp.105.070391 Mechanistic and structural studies of apoform, binary, and ternary complexes of the Arabidopsis alkenal double bond reductase At5g16970.2006 · DOI: 10.1074/jbc.m605900200
`At5g16990`	Catalyzes the reduction of the 7-8 double bond of phenylpropanal substrates, such as p-coumaryl aldehyde and coniferyl aldehyde (in vitro).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017543 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0042214 terpene metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Molecular Function

GO:0032440 2-alkenal reductase [NAD(P)H] activity Molecular Function

KEGG gene cross-reference

ag:AAQ75423

ag:BAA89423

ath:AT5G16970

ath:AT5G16990

bsu:BSU07450

nta:107830910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.696

Rank 1 · LXL04_017543 · OH-1004

Nucleus0.208

Rank 2 · LXL04_017543 · OH-1004

Peroxisome0.155

Rank 3 · LXL04_017543 · OH-1004

Mitochondrion0.088

Rank 4 · LXL04_017543 · OH-1004

Endoplasmic reticulum0.056

Rank 5 · LXL04_017543 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16884.11ADH_N_216-130 aa

PF00107.33ADH_zinc_N178-312 aa

PF13602.13ADH_zinc_N_2212-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017543	`PF16884.11`	ADH_N_2	16	130	1.7e-15	57.5
LXL04_017543	`PF00107.33`	ADH_zinc_N	178	312	2.6e-23	83.1
LXL04_017543	`PF13602.13`	ADH_zinc_N_2	212	353	1.6e-06	29.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39172`	Arabidopsis thaliana	NADPH-dependent oxidoreductase 2-alkenal reductase	36.826%	Swiss-Prot	moderate database homology
`Q39173`	Arabidopsis thaliana	NADP-dependent alkenal double bond reductase P2	36.637%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card