LXL04_017443 | RubberDandelionOmics

Gene overview

LXL04_017443

Reference: OH-1004 Chr: Chr03 Coordinates: 149380829-149384680 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1848 bp · LXL04_017443|LXL04_017443|OH1004|cDNA

ATGTATAGTTGTATACATAATATGTGCAAGTTTGTCCTTATCTCGTGGACATGTCAGATTGTTAATTATCGGGCAACGCTTCGTAAGGACTCTAAATGCTCGTTCAACATCCTTTCTACCTTTTCTTCTCGCGTTTTGAGCTTTTCTATATTTTTCTTAGAGATTTTTATGTCAAATATAATAAGTTTTTCTCTCGCCTTCAGCTTATCATTTATCATGGTCAATGAGCAAGATCCCGACTCGATACAGTATGATGTCAA...

CDS

Download CDS FASTA

1848 bp · LXL04_017443|LXL04_017443|OH1004|CDS

ATGTATAGTTGTATACATAATATGTGCAAGTTTGTCCTTATCTCGTGGACATGTCAGATTGTTAATTATCGGGCAACGCTTCGTAAGGACTCTAAATGCTCGTTCAACATCCTTTCTACCTTTTCTTCTCGCGTTTTGAGCTTTTCTATATTTTTCTTAGAGATTTTTATGTCAAATATAATAAGTTTTTCTCTCGCCTTCAGCTTATCATTTATCATGGTCAATGAGCAAGATCCCGACTCGATACAGTATGATGTCAA...

Protein

Download Protein FASTA

615 aa · LXL04_017443|LXL04_017443|OH1004|PROTEIN

MYSCIHNMCKFVLISWTCQIVNYRATLRKDSKCSFNILSTFSSRVLSFSIFFLEIFMSNIISFSLAFSLSFIMVNEQDPDSIQYDVKRTDFPDNFMFGVGTSAYQVEGGWNVDGKGLSNWDTFILRHGDKISGGGNGCVAVDNYARWKEDVQLLKKMGVNYYRFSIPWTRILPGGKLSRGKSLKGINHYNKLIDELLDNGIKPFVTLFHWDLPNALEEEYMGFLSSKVVDDFVDFADICFWEFGDRVKDWVTLNEPYRFT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017443`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017443

Location Chr03:149380829-149384680 (-)

Description Similar to SGR1: Strictosidine-O-beta-D-glucosidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0320200`	Beta-glucosidase 24.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017443 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009821 alkaloid biosynthetic process Biological Process

GO:0016052 carbohydrate catabolic process Biological Process

GO:0051259 protein complex oligomerization Biological Process

GO:0005634 nucleus Cellular Component

GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Molecular Function

GO:0004565 beta-galactosidase activity Molecular Function

GO:0008422 beta-glucosidase activity Molecular Function

GO:0033907 beta-D-fucosidase activity Molecular Function

GO:0050247 raucaffricine beta-glucosidase activity Molecular Function

GO:0050392 vicianin beta-glucosidase activity Molecular Function

KEGG gene cross-reference

ag:AAF03675

ag:AAL93619

ag:CAC83098

dosa:Os06g0320200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.341

Rank 1 · LXL04_017443 · OH-1004

Lysosome / Vacuole0.309

Rank 2 · LXL04_017443 · OH-1004

Cytoplasm0.137

Rank 3 · LXL04_017443 · OH-1004

Cell membrane0.079

Rank 4 · LXL04_017443 · OH-1004

Extracellular0.067

Rank 5 · LXL04_017443 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232.25Glyco_hydro_189-573 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017443	`PF00232.25`	Glyco_hydro_1	89	573	7e-133	444.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5Z9Z0`	Oryza sativa subsp. japonica	Beta-glucosidase 24	46.217%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card