LXL04_017440 | RubberDandelionOmics

Gene overview

LXL04_017440

Reference: OH-1004 Chr: Chr03 Coordinates: 149236793-149239066 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1281 bp · LXL04_017440|LXL04_017440|OH1004|cDNA

ATGGCGCAGGCCTCACAACCAGAAGAAAAATTGCGGGAAATTATCAGGGAGAAAGAGGCATCGAAGAAGGAAGAAAAAAGGGAAATCACAAACACCAATTCCCCTTCTTTTAAATTCAATGCACATGCTCCGGAATTCGTGCCAAGTTCCCATACCACCACCCAGATTCCGGTTTCCGGTTACTTCTATCCGTGTTTTAACTATCTTGGTGTCGGTGGAAATgacggtggtggtggtggtggcggtggtggttcCGGTGA...

CDS

Download CDS FASTA

1281 bp · LXL04_017440|LXL04_017440|OH1004|CDS

ATGGCGCAGGCCTCACAACCAGAAGAAAAATTGCGGGAAATTATCAGGGAGAAAGAGGCATCGAAGAAGGAAGAAAAAAGGGAAATCACAAACACCAATTCCCCTTCTTTTAAATTCAATGCACATGCTCCGGAATTCGTGCCAAGTTCCCATACCACCACCCAGATTCCGGTTTCCGGTTACTTCTATCCGTGTTTTAACTATCTTGGTGTCGGTGGAAATGACGGTGGTGGTGGTGGTGGCGGTGGTGGTTCCGGTGA...

Protein

Download Protein FASTA

426 aa · LXL04_017440|LXL04_017440|OH1004|PROTEIN

MAQASQPEEKLREIIREKEASKKEEKREITNTNSPSFKFNAHAPEFVPSSHTTTQIPVSGYFYPCFNYLGVGGNDGGGGGGGGGSGEWVYVGGSDQDQQVQFFSNPDVVIPNYSKNVLTEDLQQKIIKQVEYQFSGLSLLANESLVKHINKDPEGYVPISVIASMKKIKSCITNNHLLAQALCSSSKLVVSNDGKKVRRRHPFTEKDKEELQSRTVVAENLPEDHSHQNLEKIFNVVRSVKAIRICHPPEPNSSRSRGDY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017440`
TK1151 ID	TkA02G105340
OH-1004 ID	LXL04_017440
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017440

Location Chr03:149236793-149239066 (-)

Description Similar to LARP6C: La-related protein 6C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19090`	Transcriptional regulator.	No verified direct reference in this release
`At2g43970`	Transcriptional regulator.	No verified direct reference in this release
`At5g46250`	Transcriptional regulator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017440 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0000494 box C/D sno(s)RNA 3'-end processing Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006396 RNA processing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009846 pollen germination Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0030154 cell differentiation Biological Process

GO:0032897 negative regulation of viral transcription Biological Process

GO:0036093 germ cell proliferation Biological Process

KEGG gene cross-reference

ath:AT2G43970

ath:AT3G19090

ath:AT5G46250

mmu:28036

rno:686883

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.607

Rank 1 · LXL04_017440 · OH-1004

Cytoplasm0.409

Rank 2 · LXL04_017440 · OH-1004

Cell membrane0.060

Rank 3 · LXL04_017440 · OH-1004

Endoplasmic reticulum0.040

Rank 4 · LXL04_017440 · OH-1004

Mitochondrion0.026

Rank 5 · LXL04_017440 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05383.24La126-182 aa

PF00076.29RRM_1219-287 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017440	`PF05383.24`	La	126	182	6e-16	58.8
LXL04_017440	`PF00076.29`	RRM_1	219	287	6e-07	29.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHL3`	Arabidopsis thaliana	La-related protein 6C	55.120%	Swiss-Prot	strong database homology
`O80567`	Arabidopsis thaliana	La-related protein 6B	51.786%	Swiss-Prot	moderate database homology
`Q94A38`	Arabidopsis thaliana	La-related protein 6A	36.994%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card