LXL04_017427 | RubberDandelionOmics

Gene overview

LXL04_017427

Reference: OH-1004 Chr: Chr03 Coordinates: 148755479-148762804 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5115 bp · LXL04_017427|LXL04_017427|OH1004|cDNA

ATGTTTTCTTGGAACTTCGCCAAATCGGCGGAGGCGGTGTTCTCTCGGTTGGCCATAAAGAAGGTCTGCAAGTTTTTGTTGAAGAAGAAATTAGGGCAACTTATTCTTGGCGACATCGATCTTAATCAGCTTGATGTTCAGCTTAGCAACGGCACAATTCAGCTCTCTGATTTGGCACTTAACGTCGATTTTATCAATCAGAAGTTTGGCGAATCAGCTATTTTGACTGTGAAAGAAGGATCGATAGGCTCTCTAACTGT...

CDS

Download CDS FASTA

5115 bp · LXL04_017427|LXL04_017427|OH1004|CDS

ATGTTTTCTTGGAACTTCGCCAAATCGGCGGAGGCGGTGTTCTCTCGGTTGGCCATAAAGAAGGTCTGCAAGTTTTTGTTGAAGAAGAAATTAGGGCAACTTATTCTTGGCGACATCGATCTTAATCAGCTTGATGTTCAGCTTAGCAACGGCACAATTCAGCTCTCTGATTTGGCACTTAACGTCGATTTTATCAATCAGAAGTTTGGCGAATCAGCTATTTTGACTGTGAAAGAAGGATCGATAGGCTCTCTAACTGT...

Protein

Download Protein FASTA

1704 aa · LXL04_017427|LXL04_017427|OH1004|PROTEIN

MFSWNFAKSAEAVFSRLAIKKVCKFLLKKKLGQLILGDIDLNQLDVQLSNGTIQLSDLALNVDFINQKFGESAILTVKEGSIGSLTVRLPWKGRNCEIEVEELEIVLAPGRQISSQVENEPSTSNQDSNNTYTSHSFMKPEHEMADSTISNPTVDIHEGVKTIAKMVKWLLTSFHVKIKKLIIALDPVSEEGHTHNRTLVLRFGEVECGTGISDEVNTIDHESVDSFLGLSRLTNFVKFDGAVLEFLHLDDTGPNGPNEF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017427`
TK1151 ID	TkA02G044810
OH-1004 ID	LXL04_017427
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.800
Protein coverage (%)	TK1151 98.932 / OH-1004 75.880 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017427

Location Chr03:148755479-148762804 (-)

Description Similar to ATG2: Autophagy-related protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19190`	Lipid transfer protein involved in autophagosome assembly.	ATG2, an autophagy-related protein, negatively affects powdery mildew resistance and mildew-induced cell death in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04669.x Highly oxidized peroxisomes are selectively degraded via autophagy in Arabidopsis.2013 · DOI: 10.1105/tpc.113.116947

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017427 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000422 autophagy of mitochondrion Biological Process

GO:0000425 pexophagy Biological Process

GO:0006869 lipid transport Biological Process

GO:0010150 leaf senescence Biological Process

GO:0015031 protein transport Biological Process

GO:0034727 piecemeal microautophagy of the nucleus Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0061709 reticulophagy Biological Process

GO:0061723 glycophagy Biological Process

GO:0000407 phagophore assembly site Cellular Component

KEGG gene cross-reference

ath:AT3G19190

cnb:CNBB5000

nfi:NFIA_059120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.318

Rank 1 · LXL04_017427 · OH-1004

Cytoplasm0.251

Rank 2 · LXL04_017427 · OH-1004

Golgi apparatus0.220

Rank 3 · LXL04_017427 · OH-1004

Nucleus0.181

Rank 4 · LXL04_017427 · OH-1004

Mitochondrion0.154

Rank 5 · LXL04_017427 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13329.14ATG2_CAD20-1333 aa

PF13329.14ATG2_CAD1344-1431 aa

PF13329.14ATG2_CAD1429-1695 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017427	`PF13329.14`	ATG2_CAD	20	1333	2.2e-152	510.4
LXL04_017427	`PF13329.14`	ATG2_CAD	1344	1431	2.2e-152	510.4
LXL04_017427	`PF13329.14`	ATG2_CAD	1429	1695	2.2e-152	510.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F8S296`	Arabidopsis thaliana	Autophagy-related protein 2	37.711%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card