LXL04_017401 | RubberDandelionOmics

Gene overview

LXL04_017401

Reference: OH-1004 Chr: Chr03 Coordinates: 148311231-148313522 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2292 bp · LXL04_017401|LXL04_017401|OH1004|cDNA

ATGGCACAGTCCATGAATCTTCGATTTGTCTCCTTCATCTGCACTTTCGTAAGCATCGTATCAATGATTTCATCATCTTCATTAGATGATTATCGAGCTTACATCGTTCATATGGACAAATCGATGATGCCATCACCCTTCTCTCATCACCACGACTGGTACACTTCTGTACTTTCATCCCTCTCATATGAAGCATCTCCGGCGATGCATCTTTACACGTATAACCATGTCATGGACGGATTCAGTGCAGTCCTGACAAA...

CDS

Download CDS FASTA

2292 bp · LXL04_017401|LXL04_017401|OH1004|CDS

ATGGCACAGTCCATGAATCTTCGATTTGTCTCCTTCATCTGCACTTTCGTAAGCATCGTATCAATGATTTCATCATCTTCATTAGATGATTATCGAGCTTACATCGTTCATATGGACAAATCGATGATGCCATCACCCTTCTCTCATCACCACGACTGGTACACTTCTGTACTTTCATCCCTCTCATATGAAGCATCTCCGGCGATGCATCTTTACACGTATAACCATGTCATGGACGGATTCAGTGCAGTCCTGACAAA...

Protein

Download Protein FASTA

763 aa · LXL04_017401|LXL04_017401|OH1004|PROTEIN

MAQSMNLRFVSFICTFVSIVSMISSSSLDDYRAYIVHMDKSMMPSPFSHHHDWYTSVLSSLSYEASPAMHLYTYNHVMDGFSAVLTKSQLAQLEKMPGHLATFEEKLGQLHTTHTPKFLGLKKHAGLWPASNFGEDMIVGILDTGIWPESQSFHDKGMSEVPSRWRGACEIESFCNKKIIGARSFSQGMKRRRENISSTDDYDSPRDYEGHGTHTSSTATGSRVQFADYFGYAKGTATGIAPNSRLAMYKVLFLNDSYEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017401`
TK1151 ID	TkA02G045270
OH-1004 ID	LXL04_017401
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.300
Protein coverage (%)	TK1151 100.000 / OH-1004 75.360 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017401

Location Chr03:148311231-148313522 (+)

Description Similar to SBT1.7: Subtilisin-like protease SBT1.7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67360`	Serine protease.	Ara12 subtilisin-like protease from Arabidopsis thaliana: purification, substrate specificity and tissue localization.2003 · DOI: 10.1042/bj20021125 A subtilisin-like serine protease essential for mucilage release from Arabidopsis seed coats.2008 · DOI: 10.1111/j.1365-313x.2008.03437.x
`At5g51750`	Subtilisin-like protease SBT1.3.	No verified direct reference in this release
`At3g14067`	Subtilisin-like protease SBT1.4.	No verified direct reference in this release
`At4g34980`	Subtilisin-like protease SBT1.6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017401 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010214 seed coat development Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0043171 peptide catabolic process Biological Process

GO:0048731 system development Biological Process

GO:0080001 mucilage extrusion from seed coat Biological Process

GO:0097264 self proteolysis Biological Process

KEGG gene cross-reference

ath:AT3G14067

ath:AT4G34980

ath:AT5G51750

ath:AT5G67360

sly:543726

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.426

Rank 1 · LXL04_017401 · OH-1004

Lysosome / Vacuole0.197

Rank 2 · LXL04_017401 · OH-1004

Cell membrane0.114

Rank 3 · LXL04_017401 · OH-1004

Cytoplasm0.101

Rank 4 · LXL04_017401 · OH-1004

Endoplasmic reticulum0.093

Rank 5 · LXL04_017401 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922.22Inhibitor_I934-110 aa

PF00082.28Peptidase_S8134-581 aa

PF17766.8fn3_6648-754 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017401	`PF05922.22`	Inhibitor_I9	34	110	3e-15	57.4
LXL04_017401	`PF00082.28`	Peptidase_S8	134	581	1.5e-44	153.1
LXL04_017401	`PF17766.8`	fn3_6	648	754	7.7e-22	78.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65351`	Arabidopsis thaliana	Subtilisin-like protease SBT1.7	42.781%	Swiss-Prot	moderate database homology
`Q9FLI4`	Arabidopsis thaliana	Subtilisin-like protease SBT1.3	39.346%	Swiss-Prot	moderate database homology
`Q9LVJ1`	Arabidopsis thaliana	Subtilisin-like protease SBT1.4	40.587%	Swiss-Prot	moderate database homology
`O49607`	Arabidopsis thaliana	Subtilisin-like protease SBT1.6	41.524%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card