LXL04_017396 | RubberDandelionOmics

Gene overview

LXL04_017396

Reference: OH-1004 Chr: Chr03 Coordinates: 148164089-148176443 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4206 bp · LXL04_017396|LXL04_017396|OH1004|cDNA

ATGCTTGaacaagaagaaaagaaagcGAAATATGAAAGCGAGCAATCCTTAAGCCTTGAGAGGGACTTTGACGAAGAAGAGATTAAAAAAGCGATCTGGAATTGCGGAGAAGACAAAACACCGGGCCCAAACGGTTTTAATATGGAATTCATCAAAAGAATGTGGCACATAGTCGGAACGGATATCACATCAGCAATCAAAGAGTTTGGCCGGAAAGCGTGTATTCCTCGGGGGGTTAATGCTGGGTTTTTGGCCCTTAA...

CDS

Download CDS FASTA

4206 bp · LXL04_017396|LXL04_017396|OH1004|CDS

ATGCTTGAACAAGAAGAAAAGAAAGCGAAATATGAAAGCGAGCAATCCTTAAGCCTTGAGAGGGACTTTGACGAAGAAGAGATTAAAAAAGCGATCTGGAATTGCGGAGAAGACAAAACACCGGGCCCAAACGGTTTTAATATGGAATTCATCAAAAGAATGTGGCACATAGTCGGAACGGATATCACATCAGCAATCAAAGAGTTTGGCCGGAAAGCGTGTATTCCTCGGGGGGTTAATGCTGGGTTTTTGGCCCTTAA...

Protein

Download Protein FASTA

1401 aa · LXL04_017396|LXL04_017396|OH1004|PROTEIN

MLEQEEKKAKYESEQSLSLERDFDEEEIKKAIWNCGEDKTPGPNGFNMEFIKRMWHIVGTDITSAIKEFGRKACIPRGVNAGFLALNPKKLDAVTVNDFRPISLVGVLYKIIAKILATRIKVVLNHIISPNQSAFVKDRQILDGPLLISEIIAWTKKKKKKYLMFKTDIAKAYDSVDWRYLDKVMRAMNFGFKWRNWIRTCLRSSSLSILVNGSATKEFDMKRGLRQGDPMSPFLFTLVMEGLSLALSKAEDNEAYKAII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017396`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017396

Location Chr03:148164089-148176443 (+)

Description Similar to FPP7: Filament-like plant protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23360`	Filament-like plant protein 7.	No verified direct reference in this release
`At1g19835`	Filament-like plant protein 4.	No verified direct reference in this release
`At4g36120`	Filament-like plant protein 5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017396 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010090 trichome morphogenesis Biological Process

GO:0046785 microtubule polymerization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003824 catalytic activity Molecular Function

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G19835

ath:AT2G23360

ath:AT4G36120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.597

Rank 1 · LXL04_017396 · OH-1004

Nucleus0.300

Rank 2 · LXL04_017396 · OH-1004

Cell membrane0.192

Rank 3 · LXL04_017396 · OH-1004

Endoplasmic reticulum0.046

Rank 4 · LXL04_017396 · OH-1004

Golgi apparatus0.042

Rank 5 · LXL04_017396 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078.33RVT_196-249 aa

PF05911.17FPP591-792 aa

PF05911.17FPP839-933 aa

PF05911.17FPP965-1079 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017396	`PF00078.33`	RVT_1	96	249	8.1e-25	88.6
LXL04_017396	`PF05911.17`	FPP	591	792	2.8e-96	324.4
LXL04_017396	`PF05911.17`	FPP	839	933	2.8e-96	324.4
LXL04_017396	`PF05911.17`	FPP	965	1079	2.8e-96	324.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLN1`	Arabidopsis thaliana	Filament-like plant protein 7	32.857%	Swiss-Prot	weak database homology
`Q0WSY2`	Arabidopsis thaliana	Filament-like plant protein 4	32.432%	Swiss-Prot	weak database homology
`O65649`	Arabidopsis thaliana	Filament-like plant protein 5	36.752%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card