LXL04_017382 | RubberDandelionOmics

Gene overview

LXL04_017382

Reference: OH-1004 Chr: Chr03 Coordinates: 147917462-147918607 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1146 bp · LXL04_017382|LXL04_017382|OH1004|cDNA

ATGTCCACCGCCGTCGTATCTTTCCTCACCCTCCTCCTCGTCGCCACCGTCTCCACTGCCCTCACCACCTTCCCATCTGATATTGCCGCTCTGAAAGCCATTAAATCCTCCGTCAACCCCACTACTATACCTTCGTTCACTTGTTTATACTCATGGGACTTCACCTCCGATCCTTGTTCGCCGCCGCATGTAACTCATTTCCTCTGTGGATTGTCCTGCTCCGGCAATCGGGTTACTCAGCTTACCCTTGACCCCGCCGG...

CDS

Download CDS FASTA

1146 bp · LXL04_017382|LXL04_017382|OH1004|CDS

ATGTCCACCGCCGTCGTATCTTTCCTCACCCTCCTCCTCGTCGCCACCGTCTCCACTGCCCTCACCACCTTCCCATCTGATATTGCCGCTCTGAAAGCCATTAAATCCTCCGTCAACCCCACTACTATACCTTCGTTCACTTGTTTATACTCATGGGACTTCACCTCCGATCCTTGTTCGCCGCCGCATGTAACTCATTTCCTCTGTGGATTGTCCTGCTCCGGCAATCGGGTTACTCAGCTTACCCTTGACCCCGCCGG...

Protein

Download Protein FASTA

381 aa · LXL04_017382|LXL04_017382|OH1004|PROTEIN

MSTAVVSFLTLLLVATVSTALTTFPSDIAALKAIKSSVNPTTIPSFTCLYSWDFTSDPCSPPHVTHFLCGLSCSGNRVTQLTLDPAGYVGTLSPLVSQLTQLITIDLSDNKFSGPIPNSLFFLPNLQTLMLGSNSFSGVIPPSISNLKSLQTLDISRNSLSGSLPKTLTSLTALTRLDLSFNKLTGPIPGLPKNIVQLALKGNSLYGYLLKQSFLGLAQLETVELSENSLTGTIPGWFFLIPSLQQVNLAKNSFTGVEIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017382`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017382

Location Chr03:147917462-147918607 (-)

Description Similar to DRT100: DNA damage-repair/toleration protein DRT100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12610`	This protein is able to complement bacterial recA mutations, but its native function in the plant is not known.	No verified direct reference in this release
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At3g24240`	Together with RGI2, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0576900`	Functions in the early stages of organ development by regulating cell division rate.	XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassinosteroids and cell cycling in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04877.x
`Os07g0568700`	Inhibitor of fungal polygalacturonase.	The OsFOR1 gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice.2003 · DOI: 10.1023/b:plan.0000006940.89955.f1

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017382 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0090696 post-embryonic plant organ development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0004672 protein kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G12610

dosa:Os04g0576900

osa:4336741

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.376

Rank 1 · LXL04_017382 · OH-1004

Cell membrane0.302

Rank 2 · LXL04_017382 · OH-1004

Endoplasmic reticulum0.137

Rank 3 · LXL04_017382 · OH-1004

Cytoplasm0.075

Rank 4 · LXL04_017382 · OH-1004

Plastid0.037

Rank 5 · LXL04_017382 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_1491-249 aa

PF13855.13LRR_898-135 aa

PF13855.13LRR_8124-184 aa

PF12799.14LRR_4124-161 aa

PF12799.14LRR_4148-192 aa

PF13855.13LRR_8198-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017382	`PF23598.2`	LRR_14	91	249	1.2e-07	31.6
LXL04_017382	`PF13855.13`	LRR_8	98	135	2.3e-28	98.5
LXL04_017382	`PF13855.13`	LRR_8	124	184	2.3e-28	98.5
LXL04_017382	`PF12799.14`	LRR_4	124	161	2.4e-19	69.6
LXL04_017382	`PF12799.14`	LRR_4	148	192	2.4e-19	69.6
LXL04_017382	`PF13855.13`	LRR_8	198	253	2.3e-28	98.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q00874`	Arabidopsis thaliana	DNA damage-repair/toleration protein DRT100	32.934%	Swiss-Prot	moderate database homology
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	35.943%	Swiss-Prot	moderate database homology
`Q9LHP4`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI1	33.824%	Swiss-Prot	moderate database homology
`G9LZD7`	Oryza sativa subsp. japonica	Probable inactive leucine-rich repeat receptor kinase XIAO	38.168%	Swiss-Prot	moderate database homology
`Q8GT95`	Oryza sativa subsp. japonica	Polygalacturonase inhibitor 1	35.495%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card