LXL04_017350 | RubberDandelionOmics

Gene overview

LXL04_017350

Reference: OH-1004 Chr: Chr03 Coordinates: 147055280-147057393 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1245 bp · LXL04_017350|LXL04_017350|OH1004|cDNA

ATGTTATCGGTAATATGCGGAGTAGCGGGTAGCGTCGTTCTTTGGGTGCCTCAAGCCCACCGTCTTCACTCTTCTGTGGAGAATGCAAAAATGAAAGCAAAAGATGAAAGGGAATGCAAGGGTGTGGGTGTCGGTAGGCTATATGGAGAAGAAAAGGAGGAAGATGAAAAAAGGAAGATGACGAAAGGGTTTGCAATTGGGATAGCAAGTGGGTGCAACATTTCATCAAGTGGGGTTTACAAAAAGAGGTCAACGAGAGC...

CDS

Download CDS FASTA

1245 bp · LXL04_017350|LXL04_017350|OH1004|CDS

ATGTTATCGGTAATATGCGGAGTAGCGGGTAGCGTCGTTCTTTGGGTGCCTCAAGCCCACCGTCTTCACTCTTCTGTGGAGAATGCAAAAATGAAAGCAAAAGATGAAAGGGAATGCAAGGGTGTGGGTGTCGGTAGGCTATATGGAGAAGAAAAGGAGGAAGATGAAAAAAGGAAGATGACGAAAGGGTTTGCAATTGGGATAGCAAGTGGGTGCAACATTTCATCAAGTGGGGTTTACAAAAAGAGGTCAACGAGAGC...

Protein

Download Protein FASTA

414 aa · LXL04_017350|LXL04_017350|OH1004|PROTEIN

MLSVICGVAGSVVLWVPQAHRLHSSVENAKMKAKDERECKGVGVGRLYGEEKEEDEKRKMTKGFAIGIASGCNISSSGVYKKRSTRAKIRRPPQAKGALPIIGHLHLLSGPQLPHHVLGNMAEKHGLIFSIKLGLQDVVVVSNGMIAKSCFTTNDKAFATRPKSEATKLLAYDYAVFGFAPYGEYWRQMRKMFKSEVLSQKRVEMFGHVRGSELKESIKDLYDEMSPNSEMVKVEMDQWFGNLVVNIMVRVIIGKRYSLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017350`
TK1151 ID	TkA02G048490
OH-1004 ID	LXL04_017350
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.900
Protein coverage (%)	TK1151 91.411 / OH-1004 80.676 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017350

Location Chr03:147055280-147057393 (-)

Description Similar to CYP82A3: Cytochrome P450 82A3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31940`	Can hydroxylate xanthotoxin (8-methoxypsoralen) to form 5- hydroxyxanthotoxin (5-hydroxy-8-methoxypsoralen) in vivo and in vitro.	In planta biocatalysis screen of P450s identifies 8-methoxypsoralen as a substrate for the CYP82C subfamily, yielding original chemical structures.2008 · DOI: 10.1016/j.chembiol.2008.01.008 Arabidopsis CYP82C4 expression is dependent on Fe availability and circadian rhythm, and correlates with genes involved in the early Fe deficiency response.2011 · DOI: 10.1016/j.jplph.2010.11.020

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017350 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009821 alkaloid biosynthetic process Biological Process

GO:0010039 response to iron ion Biological Process

GO:0010446 response to alkaline pH Biological Process

GO:0071281 cellular response to iron ion Biological Process

GO:0106146 sideretin biosynthesis Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

KEGG gene cross-reference

ag:ALG05144

ag:UQZ09627

ath:AT4G31940

gmx:100789386

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.903

Rank 1 · LXL04_017350 · OH-1004

Plastid0.044

Rank 2 · LXL04_017350 · OH-1004

Cytoplasm0.041

Rank 3 · LXL04_017350 · OH-1004

Cell membrane0.040

Rank 4 · LXL04_017350 · OH-1004

Nucleus0.025

Rank 5 · LXL04_017350 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45093-405 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017350	`PF00067.28`	p450	93	405	2.5e-39	136.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ46`	Arabidopsis thaliana	Xanthotoxin 5-hydroxylase CYP82C4	42.901%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card