Gene Card
Gene overview
cDNA / CDS / Protein Sequences
891 bp · LXL04_017347|LXL04_017347|OH1004|cDNA
ATGGATATACGTAAACTCGACGTATCGGGGGTCCGAGGGCAGCCCCCTGGAGACGGTGTTTCCAAAGGGGCAGTGCCCCTTTGAGATGTTAAATGGATGTCGGGATTGCTTATATCCAATTTTGACACTAATCAAAAGCAAATTGACACATTGCCATCAACCAAGAGTCCAAGACCCTTGGGTTTTTTTATACGGTATACGGATTACAAAGTTGAAGCCGGATCGTCCGCGGATTATAGCGCACGATTTTCACGCCCTCC...
795 bp · LXL04_017347|LXL04_017347|OH1004|CDS
ATGTCGGGATTGCTTATATCCAATTTTGACACTAATCAAAAGCAAATTGACACATTGCCATCAACCAAGAGTCCAAGACCCTTGGGTTTTTTTATACGGTATACGGATTACAAAGTTGAAGCCGGATCGTCCGCGGATTATAGCGCACGATTTTCACGCCCTCCTCTTGCTCTCTGTCTCTCAGTCAAAATGTCCGATAACCCTCTGGACACAATCTGCAGCACCATTGGAAGAATTACAGTGTCACTTCAAACAAAATT...
Protein
Download Protein FASTA264 aa · LXL04_017347|LXL04_017347|OH1004|PROTEIN
MSGLLISNFDTNQKQIDTLPSTKSPRPLGFFIRYTDYKVEAGSSADYSARFSRPPLALCLSVKMSDNPLDTICSTIGRITVSLQTKFSKFISIPQQPSTPTNVQVSVSAPGPPTATSSMIAAGSSFPQPTDPHTKQTSTGPVTREELGRSTWTFIHTLGAQYPEKPTRQQKKDVKELMAIISRIYPCKECADHFKEVLRSNPVQVGSQAEFSQWLCRVHNVVNRSLGKPTFPCERVDARWGKLDCEHRVCDLQGSMSLFS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_017347 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_017347 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:147015529-147018062 (-) | ||||||||||||
| Description | Similar to ERV1: FAD-linked sulfhydryl oxidase ERV1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0032496 response to lipopolysaccharide Biological Process GO:0071222 cellular response to lipopolysaccharide Biological Process GO:0071356 cellular response to tumor necrosis factor Biological Process GO:0072717 cellular response to actinomycin D Biological Process GO:0097237 cellular response to toxic substance Biological Process GO:0160203 mitochondrial disulfide relay system Biological Process GO:2000573 positive regulation of DNA biosynthetic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005615 extracellular space Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005758 mitochondrial intermembrane space Cellular Component GO:0005829 cytosol Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT1G49880 dosa:Os03g0206300 hsa:2671 mmu:11692 osa:9270137 rno:27100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04777.19Evr1_Alr149-240 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_017347 | PF04777.19 | Evr1_Alr | 149 | 240 | 8.1e-35 | 119.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.