LXL04_017243 | RubberDandelionOmics

Gene overview

LXL04_017243

Reference: OH-1004 Chr: Chr03 Coordinates: 144298358-144299294 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · LXL04_017243|LXL04_017243|OH1004|cDNA

ATGGATTCAAAATCGGATGAATATCATGGCGATGGGCTCACATTCTTTCTTCCCGAGAACAATTCTGAGATAAAAACTGGTTCGTCCGTAGGGCTTCCCATCACTAACTCAAGAAGTGCGAATTTATTTATTGTAGTGGAGTTTGATACATTTGCGAATGCGGAGTGGGATCCAAGAAACTCTAGCAATGATTTGATAGGTGATCATGTAGTTGTACTTCAGGCACTTCATTACATAATCGATATGTTGCCAGAATGGGT...

CDS

Download CDS FASTA

798 bp · LXL04_017243|LXL04_017243|OH1004|CDS

ATGGATTCAAAATCGGATGAATATCATGGCGATGGGCTCACATTCTTTCTTCCCGAGAACAATTCTGAGATAAAAACTGGTTCGTCCGTAGGGCTTCCCATCACTAACTCAAGAAGTGCGAATTTATTTATTGTAGTGGAGTTTGATACATTTGCGAATGCGGAGTGGGATCCAAGAAACTCTAGCAATGATTTGATAGGTGATCATGTAGTTGTACTTCAGGCACTTCATTACATAATCGATATGTTGCCAGAATGGGT...

Protein

Download Protein FASTA

265 aa · LXL04_017243|LXL04_017243|OH1004|PROTEIN

MDSKSDEYHGDGLTFFLPENNSEIKTGSSVGLPITNSRSANLFIVVEFDTFANAEWDPRNSSNDLIGDHVVVLQALHYIIDMLPEWVTFGFPAATGLVVQTNSVKCWAFVFNSSDLHINASNTLPPTSGSNPLNDKNITVLVVNLVVGLFVMITLLALIAFYVWRRKKSRKNEQGYDVGMNTEFEIGTRPKRFSYQELARSSGEFSENKKLGEGGFGGVYRGFLAKLGTYVAVKGCPRVQSTGSREPEPDRLEPMSHILV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017243`
TK1151 ID	TkA02G064720
OH-1004 ID	LXL04_017243
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017243

Location Chr03:144298358-144299294 (-)

Description Similar to LECRK91: L-type lectin-domain containing receptor kinase IX.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10530`	Promotes hydrogen peroxide H(2)O(2) production and cell death.	No verified direct reference in this release
`At5g65600`	Promotes hydrogen peroxide H(2)O(2) production and cell death.	No verified direct reference in this release
`At3g55550`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release
`At5g60300`	Essential receptor for extracellular ATP.	Lectin receptor kinases participate in protein-protein interactions to mediate plasma membrane-cell wall adhesions in Arabidopsis.2006 · DOI: 10.1104/pp.105.066464 Identification of a plant receptor for extracellular ATP.2014 · DOI: 10.1126/science.343.6168.290

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0640500`	Lectin-domain containing receptor kinase involved in salt stress response.	The Receptor-Like Kinase SIT1 Mediates Salt Sensitivity by Activating MAPK3/6 and Regulating Ethylene Homeostasis in Rice.2014 · DOI: 10.1105/tpc.114.125187 Mutual Regulation of Receptor-Like Kinase SIT1 and B'κ-PP2A Shapes the Early Response of Rice to Salt Stress.2019 · DOI: 10.1105/tpc.18.00706

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017243 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048041 focal adhesion assembly Biological Process

GO:0071318 cellular response to ATP Biological Process

GO:0106167 extracellular ATP signaling Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT3G55550

ath:AT5G10530

ath:AT5G60300

ath:AT5G65600

dosa:Os02g0640500

osa:4330111

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.602

Rank 1 · LXL04_017243 · OH-1004

Endoplasmic reticulum0.168

Rank 2 · LXL04_017243 · OH-1004

Cytoplasm0.106

Rank 3 · LXL04_017243 · OH-1004

Lysosome / Vacuole0.096

Rank 4 · LXL04_017243 · OH-1004

Extracellular0.077

Rank 5 · LXL04_017243 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00139.27Lectin_legB6-60 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017243	`PF00139.27`	Lectin_legB	6	60	3.1e-13	50.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXA5`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IX.1	29.010%	Swiss-Prot	weak database homology
`Q9LSL5`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IX.2	26.403%	Swiss-Prot	weak database homology
`Q9M2S4`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase S.4	30.168%	Swiss-Prot	moderate database homology
`Q9LSR8`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase I.9	31.818%	Swiss-Prot	moderate database homology
`Q6H7D2`	Oryza sativa subsp. japonica	L-type lectin-domain containing receptor kinase SIT1	30.189%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card