LXL04_017242 | RubberDandelionOmics

Gene overview

LXL04_017242

Reference: OH-1004 Chr: Chr03 Coordinates: 144292395-144294437 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2043 bp · LXL04_017242|LXL04_017242|OH1004|cDNA

ATGTCCAGCTTAACATGCTTCCTTTTCCTTCTCACCTTCACCCCTTATGCTGCTTCGCTTAATTTCAGTTTTCCAACTATTACTCCTGAAAATTACAAGGAGATAGTAACAACAGGTGGTGGAGCATCAATCACTGACGACGGGATCCAGGTGACTCCAGAACTTTATCGTAAATGGTCAGCAGGCAGGGCGACATACTTCAGGCCGCTTCATCTATGGGACAAGAACTCTACTCAGCTAGCCAGCTTCTCTACAAGTTT...

CDS

Download CDS FASTA

2043 bp · LXL04_017242|LXL04_017242|OH1004|CDS

ATGTCCAGCTTAACATGCTTCCTTTTCCTTCTCACCTTCACCCCTTATGCTGCTTCGCTTAATTTCAGTTTTCCAACTATTACTCCTGAAAATTACAAGGAGATAGTAACAACAGGTGGTGGAGCATCAATCACTGACGACGGGATCCAGGTGACTCCAGAACTTTATCGTAAATGGTCAGCAGGCAGGGCGACATACTTCAGGCCGCTTCATCTATGGGACAAGAACTCTACTCAGCTAGCCAGCTTCTCTACAAGTTT...

Protein

Download Protein FASTA

680 aa · LXL04_017242|LXL04_017242|OH1004|PROTEIN

MSSLTCFLFLLTFTPYAASLNFSFPTITPENYKEIVTTGGGASITDDGIQVTPELYRKWSAGRATYFRPLHLWDKNSTQLASFSTSFTFVIDSYQSDDYGDGLTFFLAENRSMLESNLGDVYGGGALGLPVNQTTNLSNVSFVAVEFDTFYNLQWDPTNHSHVGININNLSSVTYAACPSANISISQEFQVLIKYDSVSKNLSVSFTTDNPYGVGTIHYSIDLREVLPEWVIFGFSAATGFSYQKNNVKSWTFNSSILHV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017242`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017242

Location Chr03:144292395-144294437 (+)

Description Similar to LECRK91: L-type lectin-domain containing receptor kinase IX.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10530`	Promotes hydrogen peroxide H(2)O(2) production and cell death.	No verified direct reference in this release
`At5g65600`	Promotes hydrogen peroxide H(2)O(2) production and cell death.	No verified direct reference in this release
`At5g55830`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici.	No verified direct reference in this release
`At3g55550`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release
`At4g02410`	L-type lectin-domain containing receptor kinase IV.3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017242 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G55550

ath:AT4G02410

ath:AT5G10530

ath:AT5G55830

ath:AT5G65600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.841

Rank 1 · LXL04_017242 · OH-1004

Endoplasmic reticulum0.092

Rank 2 · LXL04_017242 · OH-1004

Cytoplasm0.078

Rank 3 · LXL04_017242 · OH-1004

Nucleus0.042

Rank 4 · LXL04_017242 · OH-1004

Lysosome / Vacuole0.039

Rank 5 · LXL04_017242 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00139.27Lectin_legB19-256 aa

PF18483.9Lectin_L-type_dom57-249 aa

PF03388.22Lectin_leg-like71-248 aa

PF00069.32Pkinase358-622 aa

PF07714.24PK_Tyr_Ser-Thr358-622 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017242	`PF00139.27`	Lectin_legB	19	256	1.5e-59	202.3
LXL04_017242	`PF18483.9`	Lectin_L-type_dom	57	249	1.4e-10	42.1
LXL04_017242	`PF03388.22`	Lectin_leg-like	71	248	4.8e-06	26.8
LXL04_017242	`PF00069.32`	Pkinase	358	622	1.1e-49	169.9
LXL04_017242	`PF07714.24`	PK_Tyr_Ser-Thr	358	622	3.1e-49	168.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXA5`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IX.1	45.942%	Swiss-Prot	moderate database homology
`Q9LSL5`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IX.2	43.281%	Swiss-Prot	moderate database homology
`Q9FHG4`	Arabidopsis thaliana	Probable L-type lectin-domain containing receptor kinase S.7	39.445%	Swiss-Prot	moderate database homology
`Q9M2S4`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase S.4	38.266%	Swiss-Prot	moderate database homology
`O81292`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IV.3	37.538%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card