LXL04_017207 | RubberDandelionOmics

Gene overview

LXL04_017207

Reference: OH-1004 Chr: Chr03 Coordinates: 143442950-143443498 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · LXL04_017207|LXL04_017207|OH1004|cDNA

ATGCTCGAGCTCTGCTTTTATAGTGCTATAGATCCTGGCAATTTGGCGGTTCTCAATCAGTTTAGAAAAGGGTTAAAGAATCCCGAGGTTTTGAAATGGCTGGTTAATGGCGACGATCCTTGTGGGCCACCAAGTTGGCCTCATGTATTCTGTTCTCAAACTAGGATTTTGCAGATCCAAGTTCAGGGTCTTCAGAAGAATCGGTTCACCGGAGCTTTACCTCCATTGAATGGGTTGTCGGGATTGAGGTGGGCGTATTT...

CDS

Download CDS FASTA

486 bp · LXL04_017207|LXL04_017207|OH1004|CDS

ATGCTCGAGCTCTGCTTTTATAGTGCTATAGATCCTGGCAATTTGGCGGTTCTCAATCAGTTTAGAAAAGGGTTAAAGAATCCCGAGGTTTTGAAATGGCTGGTTAATGGCGACGATCCTTGTGGGCCACCAAGTTGGCCTCATGTATTCTGTTCTCAAACTAGGATTTTGCAGATCCAAGTTCAGGGTCTTCAGAAGAATCGGTTCACCGGAGCTTTACCTCCATTGAATGGGTTGTCGGGATTGAGGTGGGCGTATTT...

Protein

Download Protein FASTA

161 aa · LXL04_017207|LXL04_017207|OH1004|PROTEIN

MLELCFYSAIDPGNLAVLNQFRKGLKNPEVLKWLVNGDDPCGPPSWPHVFCSQTRILQIQVQGLQKNRFTGALPPLNGLSGLRWAYFHYNQFDSIPPDFFNGLDCFEVLALDNNPLNTTTGWSIPIGLQNSDWSKNLTSTAKNLTSKNLTSASLNRLPKNG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017207`
TK1151 ID	TkA02G067710
OH-1004 ID	LXL04_017207
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017207

Location Chr03:143442950-143443498 (+)

Description Similar to TMK1: Receptor protein kinase TMK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66150`	Transmembrane kinase receptor.	The TMK1 gene from Arabidopsis codes for a protein with structural and biochemical characteristics of a receptor protein kinase.1992 · DOI: 10.1105/tpc.4.10.1263 Receptor-like kinase activity in membranes of Arabidopsis thaliana.1993 · DOI: 10.1016/0014-5793(93)80676-l
`At1g24650`	Involved in auxin signal transduction and cell expansion and proliferation regulation.	No verified direct reference in this release
`At2g01820`	Involved in auxin signal transduction and cell expansion and proliferation regulation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0448000`	Transmembrane kinase receptor involved in the regulation of reactive oxygen species (ROS) homeostasis, chloroplast development and leaf senescence.	WATER-SOAKED SPOT1 Controls Chloroplast Development and Leaf Senescence via Regulating Reactive Oxygen Species Homeostasis in Rice.2022 · DOI: 10.3389/fpls.2022.918673

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017207 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009555 pollen development Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0010928 regulation of auxin mediated signaling pathway Biological Process

GO:1900055 regulation of leaf senescence Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G24650

ath:AT1G66150

ath:AT2G01820

dosa:Os11g0448000

osa:4350438

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.667

Rank 1 · LXL04_017207 · OH-1004

Cytoplasm0.096

Rank 2 · LXL04_017207 · OH-1004

Endoplasmic reticulum0.092

Rank 3 · LXL04_017207 · OH-1004

Cell membrane0.070

Rank 4 · LXL04_017207 · OH-1004

Lysosome / Vacuole0.040

Rank 5 · LXL04_017207 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43298`	Arabidopsis thaliana	Receptor protein kinase TMK1	30.968%	Swiss-Prot	moderate database homology
`Q9FYK0`	Arabidopsis thaliana	Receptor-like kinase TMK2	30.058%	Swiss-Prot	moderate database homology
`Q9SIT1`	Arabidopsis thaliana	Receptor-like kinase TMK3	36.111%	Swiss-Prot	weak database homology
`Q2R560`	Oryza sativa subsp. japonica	Receptor protein kinase WSS1	33.721%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card