LXL04_017190 | RubberDandelionOmics

Gene overview

LXL04_017190

Reference: OH-1004 Chr: Chr03 Coordinates: 143023522-143025106 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

735 bp · LXL04_017190|LXL04_017190|OH1004|cDNA

ATGGTGCTACACACGCTTGAACTTTTGAAGAAAGAAGTACCCCTAGAAGAGGAATCACTATGCATACCCGAAGATATCAAAACCGGACTCGTTCTTGTTGACATCATCAATGGCTTCTGCACCATAGGAGCCGGAAACCTGGCACCAAGAGAGACAAACAACCAAATATCAGAAATGATCGACGAATCGGTCAAACTTTCAAGAGTTTTTTGCGAGAAAAAATGGCCGGTTCTCGCATTTCTAGACACTCATCAACCCGG...

CDS

Download CDS FASTA

735 bp · LXL04_017190|LXL04_017190|OH1004|CDS

ATGGTGCTACACACGCTTGAACTTTTGAAGAAAGAAGTACCCCTAGAAGAGGAATCACTATGCATACCCGAAGATATCAAAACCGGACTCGTTCTTGTTGACATCATCAATGGCTTCTGCACCATAGGAGCCGGAAACCTGGCACCAAGAGAGACAAACAACCAAATATCAGAAATGATCGACGAATCGGTCAAACTTTCAAGAGTTTTTTGCGAGAAAAAATGGCCGGTTCTCGCATTTCTAGACACTCATCAACCCGG...

Protein

Download Protein FASTA

244 aa · LXL04_017190|LXL04_017190|OH1004|PROTEIN

MVLHTLELLKKEVPLEEESLCIPEDIKTGLVLVDIINGFCTIGAGNLAPRETNNQISEMIDESVKLSRVFCEKKWPVLAFLDTHQPGKLEHPYPSHCLAGSHESNLVPPLEWLEKEPNVTIKRKDCYDGYIGSIQEDGSNAFADWVKTNNIQLLLVAGICTDICVLDFVCSTLSARNRGLLAPLEDVVVYSHGCATFDFPESATRGIKDALPHPLEIMHHMGLYMAKGRGAKIAKDVSFGALKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017190`
TK1151 ID	TkA02G069090
OH-1004 ID	LXL04_017190
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.500
Protein coverage (%)	TK1151 93.889 / OH-1004 69.262 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017190

Location Chr03:143023522-143025106 (-)

Description Similar to NIC1: Nicotinamidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22570`	May catalyze nicotinamide deamidation in the NAD⁺ salvage pathway.	Nicotinamidase participates in the salvage pathway of NAD biosynthesis in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2006.03013.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017190 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0019365 pyridine nucleotide salvage Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008936 nicotinamidase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT2G22570

bsu:BSU31760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.606

Rank 1 · LXL04_017190 · OH-1004

Nucleus0.247

Rank 2 · LXL04_017190 · OH-1004

Mitochondrion0.129

Rank 3 · LXL04_017190 · OH-1004

Cell membrane0.083

Rank 4 · LXL04_017190 · OH-1004

Endoplasmic reticulum0.077

Rank 5 · LXL04_017190 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00857.27Isochorismatase29-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017190	`PF00857.27`	Isochorismatase	29	200	3.2e-18	67.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S8F9`	Arabidopsis thaliana	Nicotinamidase 1	58.298%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card