LXL04_017132 | RubberDandelionOmics

Gene overview

LXL04_017132

Reference: OH-1004 Chr: Chr03 Coordinates: 141680721-141683249 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1062 bp · LXL04_017132|LXL04_017132|OH1004|cDNA

ATGTCATCATCACGAGAGATTGAGCGTATTTGCTGCCATGAATGTCAAGAAACTGTTCAAGTTGATGGAGATATACGGACACAATCTAGTCGACAAAGTGGTAAGTTTGTTAGCGATCTGAAGGGACTTGATGTTTGCCTTAGAAACATGTTGCATATACCCAGCCTTACGATCACGAATCCTAGTTCTATGAGTAGCGATGAGAAGTTAACTCTTGAGAAAATAAGGAATTGGCAACCGACGAAAGGGAAGCGTGCACT...

CDS

Download CDS FASTA

1062 bp · LXL04_017132|LXL04_017132|OH1004|CDS

ATGTCATCATCACGAGAGATTGAGCGTATTTGCTGCCATGAATGTCAAGAAACTGTTCAAGTTGATGGAGATATACGGACACAATCTAGTCGACAAAGTGGTAAGTTTGTTAGCGATCTGAAGGGACTTGATGTTTGCCTTAGAAACATGTTGCATATACCCAGCCTTACGATCACGAATCCTAGTTCTATGAGTAGCGATGAGAAGTTAACTCTTGAGAAAATAAGGAATTGGCAACCGACGAAAGGGAAGCGTGCACT...

Protein

Download Protein FASTA

353 aa · LXL04_017132|LXL04_017132|OH1004|PROTEIN

MSSSREIERICCHECQETVQVDGDIRTQSSRQSGKFVSDLKGLDVCLRNMLHIPSLTITNPSSMSSDEKLTLEKIRNWQPTKGKRALLCGVTYNKQKYKLKGTYYDVNRMRELLILQFKFPSSSIHILAEMDSHPRPTKRNIQEALKWLVKDNQHGDSLVFYFSGHGLRQPNFFDDEVDGFDETICPLDFRTAGMIIDNEINDTIVRPLKTGVKLHAIIDACHSGPILDLPHVYGTKERCWLDNHPPSGVYKGTSGGHAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017132`
TK1151 ID	TkA02G073140
OH-1004 ID	LXL04_017132
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017132

Location Chr03:141680721-141683249 (-)

Description Similar to AMC1: Metacaspase-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02170`	Cysteine protease that cleaves specifically after arginine or lysine residues.	Two Arabidopsis metacaspases AtMCP1b and AtMCP2b are arginine/lysine-specific cysteine proteases and activate apoptosis-like cell death in yeast.2005 · DOI: 10.1074/jbc.m413527200
`At4g25110`	Acts as a negative regulator of oxidative stress cell death and hypersensitive cell death response mediated by immune response.	No verified direct reference in this release
`At5g64240`	Metacaspase-3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017132 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006952 defense response Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004197 cysteine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

afm:AFUA_1G06700

ath:AT1G02170

ath:AT4G25110

ath:AT5G64240

ncr:NCU02400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.464

Rank 1 · LXL04_017132 · OH-1004

Nucleus0.282

Rank 2 · LXL04_017132 · OH-1004

Cell membrane0.162

Rank 3 · LXL04_017132 · OH-1004

Lysosome / Vacuole0.095

Rank 4 · LXL04_017132 · OH-1004

Endoplasmic reticulum0.078

Rank 5 · LXL04_017132 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31181.1Pept_C14_Metacaspase84-231 aa

PF00656.28Peptidase_C1484-341 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017132	`PF31181.1`	Pept_C14_Metacaspase	84	231	6e-50	170.4
LXL04_017132	`PF00656.28`	Peptidase_C14	84	341	4.3e-32	112.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XJE6`	Arabidopsis thaliana	Metacaspase-1	52.675%	Swiss-Prot	moderate database homology
`Q7XJE5`	Arabidopsis thaliana	Metacaspase-2	49.372%	Swiss-Prot	moderate database homology
`Q9FMG1`	Arabidopsis thaliana	Metacaspase-3	47.143%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card