LXL04_017069 | RubberDandelionOmics

Gene overview

LXL04_017069

Reference: OH-1004 Chr: Chr03 Coordinates: 140573630-140574454 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · LXL04_017069|LXL04_017069|OH1004|cDNA

ATGTACCAACCAACACACTTGGTGAAATTGGTCCCGATGATGCAATCGTTCATCGAAACCGCAACTCAAAATCTCCCCATAGAGAATGATAAAGATATAAACCTCAATGAACTTTCATTGAAAATGGCGACAGATGTGATTGGAAAAGCTGCATTTGGGTTTGACTTTGGTCTCTCTAAACCTAACAATCATCAGGACAACGATGAACAAATCGACTCATTTGTCAAGCAACATATATACTCCACAAAGATGCTGAAAAT...

CDS

Download CDS FASTA

825 bp · LXL04_017069|LXL04_017069|OH1004|CDS

ATGTACCAACCAACACACTTGGTGAAATTGGTCCCGATGATGCAATCGTTCATCGAAACCGCAACTCAAAATCTCCCCATAGAGAATGATAAAGATATAAACCTCAATGAACTTTCATTGAAAATGGCGACAGATGTGATTGGAAAAGCTGCATTTGGGTTTGACTTTGGTCTCTCTAAACCTAACAATCATCAGGACAACGATGAACAAATCGACTCATTTGTCAAGCAACATATATACTCCACAAAGATGCTGAAAAT...

Protein

Download Protein FASTA

274 aa · LXL04_017069|LXL04_017069|OH1004|PROTEIN

MYQPTHLVKLVPMMQSFIETATQNLPIENDKDINLNELSLKMATDVIGKAAFGFDFGLSKPNNHQDNDEQIDSFVKQHIYSTKMLKMDLPASLSIILGLLLPILQEPFRQILKRIPYTMDWKFEKTNMNLNSQLDEIVVKKMEDKERGSQDSLSLILNAREPETASMKLFTPDYISGIAYEHLLAGSATTSFSPRDQVPTADNLQSRFPYLDQVVKEVMRFYVVSPLVARETLTEVEIGGYVLPIKISNFDFSIPKIPSY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017069`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017069

Location Chr03:140573630-140574454 (+)

Description Similar to CYP711A1: Cytochrome P450 711A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26170`	Involved in the biosynthesis of strigolactone natural products, bioactive compounds promoting plant fitness and soil microbe interactions, but preventing shoot branching.	MAX1 encodes a cytochrome P450 family member that acts downstream of MAX3/4 to produce a carotenoid-derived branch-inhibiting hormone.2005 · DOI: 10.1016/j.devcel.2005.01.009 MAX1, a regulator of the flavonoid pathway, controls vegetative axillary bud outgrowth in Arabidopsis.2006 · DOI: 10.1073/pnas.0509463102 Carlactone is converted to carlactonoic acid by MAX1 in Arabidopsis and its methyl ester can directly interact with AtD14 in vitro.2014 · DOI: 10.1073/pnas.1410801111 Hydroxyl carlactone derivatives are predominant strigolactones in Arabidopsis .2020 · DOI: 10.1002/pld3.219
`At3g26310`	Cytochrome P450 71B35.	No verified direct reference in this release
`At3g26300`	Cytochrome P450 71B34.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017069 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009926 auxin polar transport Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen Molecular Function

KEGG gene cross-reference

ath:AT2G26170

ath:AT3G26300

ath:AT3G26310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.561

Rank 1 · LXL04_017069 · OH-1004

Cytoplasm0.145

Rank 2 · LXL04_017069 · OH-1004

Peroxisome0.102

Rank 3 · LXL04_017069 · OH-1004

Mitochondrion0.086

Rank 4 · LXL04_017069 · OH-1004

Nucleus0.073

Rank 5 · LXL04_017069 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p4507-192 aa

PF00067.28p450196-244 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017069	`PF00067.28`	p450	7	192	2.2e-18	67.0
LXL04_017069	`PF00067.28`	p450	196	244	2.2e-18	67.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DFU2`	Arabidopsis thaliana	Cytochrome P450 711A1	55.556%	Swiss-Prot	strong database homology
`Q9LIP5`	Arabidopsis thaliana	Cytochrome P450 71B35	22.878%	Swiss-Prot	weak database homology
`Q9LIP6`	Arabidopsis thaliana	Cytochrome P450 71B34	22.140%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card