LXL04_017066 | RubberDandelionOmics

Gene overview

LXL04_017066

Reference: OH-1004 Chr: Chr03 Coordinates: 140548882-140552290 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1857 bp · LXL04_017066|LXL04_017066|OH1004|cDNA

ATGAATCGGAAATTGCCTTTGATCCTTTATTGGTTTATTTTGGGGGTTTTTAATCTGGTAAAGGTTTATGGGAATGATGAAGGTGATGCATTGAATGACCTGAAGACACAATTAAAAGATCCTAACAATATTTTGAAAAGTTGGGATTCGACCCTTGCCAATCCATGTACTTGGTTTGGTGTAACTTGCAACGATGAGAAGAGTGTTATACGACTTGATCTTGGAAACGCAAGCTTGTCTGGTCAAATGGGTACACAGCT...

CDS

Download CDS FASTA

1857 bp · LXL04_017066|LXL04_017066|OH1004|CDS

ATGAATCGGAAATTGCCTTTGATCCTTTATTGGTTTATTTTGGGGGTTTTTAATCTGGTAAAGGTTTATGGGAATGATGAAGGTGATGCATTGAATGACCTGAAGACACAATTAAAAGATCCTAACAATATTTTGAAAAGTTGGGATTCGACCCTTGCCAATCCATGTACTTGGTTTGGTGTAACTTGCAACGATGAGAAGAGTGTTATACGACTTGATCTTGGAAACGCAAGCTTGTCTGGTCAAATGGGTACACAGCT...

Protein

Download Protein FASTA

618 aa · LXL04_017066|LXL04_017066|OH1004|PROTEIN

MNRKLPLILYWFILGVFNLVKVYGNDEGDALNDLKTQLKDPNNILKSWDSTLANPCTWFGVTCNDEKSVIRLDLGNASLSGQMGTQLVRLRNLQYLELFGNNISGRIPNEIGNLTKLVTLKLYMNRLEGNIPDTLGNLQHLCNLSLSNNNLTGAIPISLTTIASLQVIDLSNNFLIGDVPFNGSFSMFTASSFANNPNLRFVPRVPEAPPRPPRGSPNSQKFSVGNNDVRAISEGFVVGLALVFAGRAVSLTWRLCKKRQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017066`
TK1151 ID	TkA02G077220
OH-1004 ID	LXL04_017066
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	87.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017066

Location Chr03:140548882-140552290 (-)

Description Similar to BAK1: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33430`	Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.	The BRI1-associated kinase 1, BAK1, has a brassinolide-independent role in plant cell-death control.2007 · DOI: 10.1016/j.cub.2007.05.046 BAK1 and BKK1 regulate brassinosteroid-dependent growth and brassinosteroid-independent cell-death pathways.2007 · DOI: 10.1016/j.cub.2007.05.036 Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216 Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106 Phosphorylation of receptor-like cytoplasmic kinases by bacterial flagellin.2010 · DOI: 10.4161/psb.11500 The Arabidopsis leucine-rich repeat receptor-like kinases BAK1/SERK3 and BKK1/SERK4 are required for innate immunity to hemibiotrophic and biotrophic pathogens.2011 · DOI: 10.1105/tpc.111.084301 Structure of the pseudokinase domain of BIR2, a regulator of BAK1-mediated immune signaling in Arabidopsis.2014 · DOI: 10.1016/j.jsb.2014.02.005 Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306 An RLP23-SOBIR1-BAK1 complex mediates NLP-triggered immunity.2015 · DOI: 10.1038/nplants.2015.140 The SCOOP12 peptide regulates defense response and root elongation in Arabidopsis thaliana.2019 · DOI: 10.1093/jxb/ery454 The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w
`At1g34210`	Serine/threonine-kinase involved in brassinosteroid-dependent and -independent signaling pathways.	Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0174700`	LRR receptor kinase involved in defense response.	Engineering OsBAK1 gene as a molecular tool to improve rice architecture for high yield.2009 · DOI: 10.1111/j.1467-7652.2009.00444.x A subset of OsSERK genes, including OsBAK1, affects normal growth and leaf development of rice.2011 · DOI: 10.1007/s10059-011-0178-4
`UniProt: B8BB68`	LRR receptor kinase involved in defense response.	No verified direct reference in this release
`Os04g0457800`	LRR receptor kinase involved in positive regulation of somatic embryogenesis and defense response against the rice blast fungus pathogen Magnaporthe oryzae.	Rice SERK1 gene positively regulates somatic embryogenesis of cultured cell and host defense response against fungal infection.2005 · DOI: 10.1007/s00425-005-1534-4 An XA21-associated kinase (OsSERK2) regulates immunity mediated by the XA21 and XA3 immune receptors.2014 · DOI: 10.1093/mp/ssu003

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017066 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006952 defense response Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010152 pollen maturation Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0030154 cell differentiation Biological Process

GO:0040008 regulation of growth Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045089 positive regulation of innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G34210

ath:AT4G33430

dosa:Os04g0457800

dosa:Os08g0174700

osa:4336035

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.856

Rank 1 · LXL04_017066 · OH-1004

Endoplasmic reticulum0.085

Rank 2 · LXL04_017066 · OH-1004

Cytoplasm0.073

Rank 3 · LXL04_017066 · OH-1004

Nucleus0.051

Rank 4 · LXL04_017066 · OH-1004

Lysosome / Vacuole0.025

Rank 5 · LXL04_017066 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_225-64 aa

PF23598.2LRR_1472-170 aa

PF12799.14LRR_492-127 aa

PF13855.13LRR_8116-173 aa

PF12799.14LRR_4140-180 aa

PF00069.32Pkinase295-560 aa

PF07714.24PK_Tyr_Ser-Thr297-562 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017066	`PF08263.18`	LRRNT_2	25	64	1.5e-12	48.3
LXL04_017066	`PF23598.2`	LRR_14	72	170	2.6e-09	37.0
LXL04_017066	`PF12799.14`	LRR_4	92	127	2e-10	41.3
LXL04_017066	`PF13855.13`	LRR_8	116	173	7.1e-08	32.8
LXL04_017066	`PF12799.14`	LRR_4	140	180	2e-10	41.3
LXL04_017066	`PF00069.32`	Pkinase	295	560	1.4e-40	140.1
LXL04_017066	`PF07714.24`	PK_Tyr_Ser-Thr	297	562	3.8e-36	125.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94F62`	Arabidopsis thaliana	BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1	59.904%	Swiss-Prot	strong database homology
`Q9XIC7`	Arabidopsis thaliana	Somatic embryogenesis receptor kinase 2	61.678%	Swiss-Prot	strong database homology
`Q6Z4U4`	Oryza sativa subsp. japonica	LRR receptor kinase BAK1	61.849%	Swiss-Prot	strong database homology
`B8BB68`	Oryza sativa subsp. indica	LRR receptor kinase BAK1	61.500%	Swiss-Prot	strong database homology
`Q7XV05`	Oryza sativa subsp. japonica	LRR receptor kinase SERK2	59.512%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card