LXL04_017006 | RubberDandelionOmics

Gene overview

LXL04_017006

Reference: OH-1004 Chr: Chr03 Coordinates: 138799542-138800377 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

629 bp · LXL04_017006|LXL04_017006|OH1004|cDNA

ATGGCTCAGTGGTTTGTTGTGTTTCTTCAAGAAGATGTAGGGAAAGATCTTGAAAGTTTAGTGCTTTTGAGCTTCAAAGAAGCACAAAGTTTGCTACTTCAAGTTACAATTGGTTTAGCAGTAGCAGAAGCTGAATTTGAGTTTGAACACAGGGATTTACACTGGTATAGTAACCTTcataattatataatttttattatctttttagaatttatgagttttttttttgtcaattGTTTAAAAATTAAGGGGGAATATTC...

CDS

Download CDS FASTA

477 bp · LXL04_017006|LXL04_017006|OH1004|CDS

ATGGCTCAGTGGTTTGTTGTGTTTCTTCAAGAAGATGTAGGGAAAGATCTTGAAAGTTTAGTGCTTTTGAGCTTCAAAGAAGCACAAAGTTTGCTACTTCAAGTTACAATTGGTTTAGCAGTAGCAGAAGCTGAATTTGAGTTTGAACACAGGGATTTACACTGGTATAGTAACCTTCATAATTATATAATTTTTATTATCTTTTTAGAATTTATGAGTTTTTTTTTTGTCAATTGTTTAAAAATTAAGGGGGAATATTC...

Protein

Download Protein FASTA

158 aa · LXL04_017006|LXL04_017006|OH1004|PROTEIN

MAQWFVVFLQEDVGKDLESLVLLSFKEAQSLLLQVTIGLAVAEAEFEFEHRDLHWYSNLHNYIIFIIFLEFMSFFFVNCLKIKGEYSMSRKDCKTLEFIIDGKKMHVKTHGVVASIIDFTLSRINTGEDVSFLDLSLDPVLFEGPKGKEMNSRKLIGK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017006`
TK1151 ID	TkA06G022990
OH-1004 ID	LXL04_017006
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	76.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017006

Location Chr03:138799542-138800377 (-)

Description Similar to HASPIN: Serine/threonine-protein kinase haspin homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09450`	Threonine-protein kinase that phosphorylates histone H3 in vitro at 'Thr-3' (H3T3ph) and 'Thr-11' (H3T11ph), but not at 'Ser-10' (H3S10ph) or 'Ser-28' (H3S28ph).	Identification and characterization of plant Haspin kinase as a histone H3 threonine kinase.2011 · DOI: 10.1186/1471-2229-11-73 AtHaspin phosphorylates histone H3 at threonine 3 during mitosis and contributes to embryonic patterning in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04699.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017006 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0007064 mitotic sister chromatid cohesion Biological Process

GO:0007094 mitotic spindle assembly checkpoint signaling Biological Process

GO:0010467 gene expression Biological Process

GO:0034093 positive regulation of maintenance of sister chromatid cohesion Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0045143 homologous chromosome segregation Biological Process

GO:0070192 chromosome organization involved in meiotic cell cycle Biological Process

GO:0071459 protein localization to chromosome, centromeric region Biological Process

GO:0120187 positive regulation of protein localization to chromatin Biological Process

KEGG gene cross-reference

ath:AT1G09450

bta:767819

dme:Dmel_CG40080

hsa:83903

mmu:14841

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.545

Rank 1 · LXL04_017006 · OH-1004

Nucleus0.341

Rank 2 · LXL04_017006 · OH-1004

Mitochondrion0.111

Rank 3 · LXL04_017006 · OH-1004

Endoplasmic reticulum0.102

Rank 4 · LXL04_017006 · OH-1004

Cell membrane0.062

Rank 5 · LXL04_017006 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12330.15Haspin_kinase3-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017006	`PF12330.15`	Haspin_kinase	3	144	2.4e-17	63.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80528`	Arabidopsis thaliana	Serine/threonine-protein kinase haspin homolog	51.678%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card