LXL04_016829 | RubberDandelionOmics

Gene overview

LXL04_016829

Reference: OH-1004 Chr: Chr03 Coordinates: 135151650-135152630 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · LXL04_016829|LXL04_016829|OH1004|cDNA

ATGGGTTCAGAGGCCAAATTGGTCGAGAAAGTGTGTGAGATCTATGACAAAATCTCCAAACTTGAAACCCTCAAACCTTCCAAAGATGTCAACACTCTTTTCACCGAACTTGTACTCACATGCATCCCACCATCTTCCATCACCATATCCACTCTTCCTGAAAACATTCAAGAAACAAGGTCTAGGCTCATTAGACTTTGTGGTGAAGCGGAAGGCCATTTAGAGGCTCATTTCTCCACTCTTTTAGCCTCTTTTCCTAA...

CDS

Download CDS FASTA

981 bp · LXL04_016829|LXL04_016829|OH1004|CDS

ATGGGTTCAGAGGCCAAATTGGTCGAGAAAGTGTGTGAGATCTATGACAAAATCTCCAAACTTGAAACCCTCAAACCTTCCAAAGATGTCAACACTCTTTTCACCGAACTTGTACTCACATGCATCCCACCATCTTCCATCACCATATCCACTCTTCCTGAAAACATTCAAGAAACAAGGTCTAGGCTCATTAGACTTTGTGGTGAAGCGGAAGGCCATTTAGAGGCTCATTTCTCCACTCTTTTAGCCTCTTTTCCTAA...

Protein

Download Protein FASTA

326 aa · LXL04_016829|LXL04_016829|OH1004|PROTEIN

MGSEAKLVEKVCEIYDKISKLETLKPSKDVNTLFTELVLTCIPPSSITISTLPENIQETRSRLIRLCGEAEGHLEAHFSTLLASFPNPIHHLEVFPYYSNYIKLSHLEFDILTRHYSTEPGVTPKSIAFVGSGPLPLTSIVLASNHLKNTYFHNYDIDHEANSMAARLVSPDPDLSRRMFFHSTDIMEVTDELKDYDVIFLAALVGMDISEKVKVIEHLAKFMAPGGILMLRSAHGARAFLYPVVGPEDLQGFEVLSIFH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016829`
TK1151 ID	TkA02G099830
OH-1004 ID	LXL04_016829
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016829

Location Chr03:135151650-135152630 (+)

Description Similar to CHLN: Nicotianamine synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56430`	Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	No verified direct reference in this release
`At1g09240`	Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	No verified direct reference in this release
`At5g04950`	Synthesizes nicotianamine, a polyamine which serves as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0689600`	Synthesizes nicotianamine, a polyamine that is the first intermediate in the synthesis of the phytosiderophores of the mugineic acid type found in gramineae which serve as a sensor for the physiological iron status within the plant, and/or might be involved in the transport of iron.	Three rice nicotianamine synthase genes, OsNAS1, OsNAS2, and OsNAS3 are expressed in cells involved in long-distance transport of iron and differentially regulated by iron.2003 · DOI: 10.1046/j.1365-313x.2003.01878.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016829 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010233 phloem transport Biological Process

GO:0030418 nicotianamine biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0030410 nicotianamine synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G09240

ath:AT1G56430

ath:AT5G04950

dosa:Os07g0689600

sly:101248619

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.659

Rank 1 · LXL04_016829 · OH-1004

Nucleus0.358

Rank 2 · LXL04_016829 · OH-1004

Mitochondrion0.067

Rank 3 · LXL04_016829 · OH-1004

Cell membrane0.062

Rank 4 · LXL04_016829 · OH-1004

Peroxisome0.060

Rank 5 · LXL04_016829 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03059.23NAS4-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016829	`PF03059.23`	NAS	4	276	6.1e-124	413.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7X5`	Arabidopsis thaliana	Probable nicotianamine synthase 4	66.421%	Swiss-Prot	strong database homology
`O80483`	Arabidopsis thaliana	Nicotianamine synthase 3	57.831%	Swiss-Prot	strong database homology
`Q9FF79`	Arabidopsis thaliana	Nicotianamine synthase 1	59.926%	Swiss-Prot	strong database homology
`Q0D3F2`	Oryza sativa subsp. japonica	Nicotianamine synthase 3	52.038%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card