Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1587 bp · LXL04_016768|LXL04_016768|OH1004|cDNA
ATGTCAAATTGGAAAAAACAAATAGAGAATCCAAAAAGAAGTCCAGTTTGTTCGTTTGTTCCCGGCGTTCAACTTTTTGCTCTTCCCGGTGAATCTCAATCTGTGCCTGACAATGGCGATGGCGGCGAAGATATCTGTTACGCTACTGTTTTTGTATTCTCATCCGCTCAACAAACGTTTGACGTTCGTCAGCACCTGGCTACCGTTACAAGATACAACATTGGAAAAGACATTAAAGATAACTCTTTTATTCCATCAAA...
1587 bp · LXL04_016768|LXL04_016768|OH1004|CDS
ATGTCAAATTGGAAAAAACAAATAGAGAATCCAAAAAGAAGTCCAGTTTGTTCGTTTGTTCCCGGCGTTCAACTTTTTGCTCTTCCCGGTGAATCTCAATCTGTGCCTGACAATGGCGATGGCGGCGAAGATATCTGTTACGCTACTGTTTTTGTATTCTCATCCGCTCAACAAACGTTTGACGTTCGTCAGCACCTGGCTACCGTTACAAGATACAACATTGGAAAAGACATTAAAGATAACTCTTTTATTCCATCAAA...
Protein
Download Protein FASTA528 aa · LXL04_016768|LXL04_016768|OH1004|PROTEIN
MSNWKKQIENPKRSPVCSFVPGVQLFALPGESQSVPDNGDGGEDICYATVFVFSSAQQTFDVRQHLATVTRYNIGKDIKDNSFIPSNIPDQCSPIHLNLVARHGTRAPTKKRMKEMENMSTQLKSLIKDAKSRGVSTDKLPSWLSEWSSPWKGKTKGGELILQGEDEMYNLGNRIRNRFPELFSDEYRHDIYQIRASQIPRASASAVAFGMGMFSGRGKLGEGKHRAFAVLSESRASDIMLRFHDCCQNYKAYRKQQEPA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_016768 |
|---|---|
| TK1151 ID | TkA02G104400 |
| OH-1004 ID | LXL04_016768 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.300 |
| Protein coverage (%) | TK1151 95.960 / OH-1004 89.962Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_016768 |
|---|---|
| Location | Chr03:133315299-133318978 (+) |
| Description | Similar to mipp1: Multiple inositol polyphosphate phosphatase 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0001503 ossification Biological Process GO:0006007 glucose catabolic process Biological Process GO:0010226 response to lithium ion Biological Process GO:0030003 intracellular monoatomic cation homeostasis Biological Process GO:0032957 inositol trisphosphate metabolic process Biological Process GO:0043647 inositol phosphate metabolic process Biological Process GO:0048015 phosphatidylinositol-mediated signaling Biological Process GO:0005615 extracellular space Cellular Component GO:0005788 endoplasmic reticulum lumen Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component |
| KEGG gene cross-reference | ddi:DDB_G0285339 hsa:9562 mmu:17330 pon:100173135 rno:29688 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00328.28His_Phos_296-455 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_016768 | PF00328.28 | His_Phos_2 | 96 | 455 | 9.1e-56 | 190.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.