LXL04_016745 | RubberDandelionOmics

Gene overview

LXL04_016745

Reference: OH-1004 Chr: Chr03 Coordinates: 132610805-132614605 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2462 bp · LXL04_016745|LXL04_016745|OH1004|cDNA

AACATCCGGTCTCTTTTCCATTATCACTACACCAACATCACCGAGCAATCCATTTGAAAATGAACGAAACCCTAGTTACGTCATCTGAACCACCACCATCAGACGGGGATCCAATGGATGTTGTAACCGAAGCTCATAACCCTAATGAGAACCAGTCTGCCTCAAGTTCCGATTCCGACTCGGAGTCGGATGACGAAGCTCAAGTTGCACTCGAATTACAAAACCTAGAAACGGAGCTCGCCACAAACCCAGCCAACTAC...

CDS

Download CDS FASTA

2409 bp · LXL04_016745|LXL04_016745|OH1004|CDS

TTGAAAATGAACGAAACCCTAGTTACGTCATCTGAACCACCACCATCAGACGGGGATCCAATGGATGTTGTAACCGAAGCTCATAACCCTAATGAGAACCAGTCTGCCTCAAGTTCCGATTCCGACTCGGAGTCGGATGACGAAGCTCAAGTTGCACTCGAATTACAAAACCTAGAAACGGAGCTCGCCACAAACCCAGCCAACTACGATGCTCATGTTCAATATATAACGGCTCTGAGGAAGCAAGGGGATCTGGATAA...

Protein

Download Protein FASTA

802 aa · LXL04_016745|LXL04_016745|OH1004|PROTEIN

MKMNETLVTSSEPPPSDGDPMDVVTEAHNPNENQSASSSDSDSESDDEAQVALELQNLETELATNPANYDAHVQYITALRKQGDLDKLRLAREVMSELFPLTPAMWQQWGNDEISLISSSAHEGAIPAIEKLYERGVSDYTSVPLWLDYLNFLQKYDSSVSECSPSGISKARDLFERALTACGLHIAEGSKLWESYRSYEERILNTMDKTDSELREKQTQKIRSIFHRQLSIPHLDLKSTLLTYKAWESHHGNNLDVSPQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016745`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_016745`
Location	Chr03:132610805-132614605 (-)
Description	Similar to sart3: Squamous cell carcinoma antigen recognized by T-cells 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016745` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000244 spliceosomal tri-snRNP complex assembly Biological Process GO:0000245 spliceosomal complex assembly Biological Process GO:0000387 spliceosomal snRNP assembly Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0000902 cell morphogenesis Biological Process GO:0006334 nucleosome assembly Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0010468 regulation of gene expression Biological Process GO:0048872 homeostasis of number of cells Biological Process GO:0051252 regulation of RNA metabolic process Biological Process GO:0061484 hematopoietic stem cell homeostasis Biological Process
KEGG gene cross-reference	cel:CELE_B0035.12 hsa:9733 mmu:53890 pon:100171719 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.868

Rank 1 · LXL04_016745 · OH-1004

Cytoplasm0.200

Rank 2 · LXL04_016745 · OH-1004

Mitochondrion0.026

Rank 3 · LXL04_016745 · OH-1004

Cell membrane0.023

Rank 4 · LXL04_016745 · OH-1004

Golgi apparatus0.015

Rank 5 · LXL04_016745 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05843.21Suf55-559 aa

PF23240.2HAT_PRP39_N58-244 aa

PF23233.2HAT_Syf1_CNRKL1_N59-203 aa

PF23241.2HAT_PRP39_C277-356 aa

PF23233.2HAT_Syf1_CNRKL1_N277-389 aa

PF23240.2HAT_PRP39_N297-404 aa

PF00076.29RRM_1662-721 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016745	`PF05843.21`	Suf	55	559	2.1e-29	103.2
LXL04_016745	`PF23240.2`	HAT_PRP39_N	58	244	1.4e-34	120.3
LXL04_016745	`PF23233.2`	HAT_Syf1_CNRKL1_N	59	203	6.7e-21	75.4
LXL04_016745	`PF23241.2`	HAT_PRP39_C	277	356	9.6e-23	81.5
LXL04_016745	`PF23233.2`	HAT_Syf1_CNRKL1_N	277	389	6.7e-21	75.4
LXL04_016745	`PF23240.2`	HAT_PRP39_N	297	404	1.4e-34	120.3
LXL04_016745	`PF00076.29`	RRM_1	662	721	2.6e-10	40.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card