LXL04_016726 | RubberDandelionOmics

Gene overview

LXL04_016726

Reference: OH-1004 Chr: Chr03 Coordinates: 132215090-132220250 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1329 bp · LXL04_016726|LXL04_016726|OH1004|cDNA

ATGGCTTATCACTCACCTGTGCATACGCTATCATTAGGCTATTGGGTGTGGTCCGACGTCGAGGAGAACGCGGCTGAGGTGGGGGGGGAGAACGGCGTTGCAGGGGGGGAACACCGCCCCCATGGTCGGCGTCGTCCTCTTCGCGTTGTGGTGCATCGCTCTCGCAATGGGCAGGAACGCCTCGTTGCTcctcttttcttctcttctttctccctgtttctctctttctcttctctTTTCTCCCGGTTTCTCTCTTTCTC...

CDS

Download CDS FASTA

1329 bp · LXL04_016726|LXL04_016726|OH1004|CDS

ATGGCTTATCACTCACCTGTGCATACGCTATCATTAGGCTATTGGGTGTGGTCCGACGTCGAGGAGAACGCGGCTGAGGTGGGGGGGGAGAACGGCGTTGCAGGGGGGGAACACCGCCCCCATGGTCGGCGTCGTCCTCTTCGCGTTGTGGTGCATCGCTCTCGCAATGGGCAGGAACGCCTCGTTGCTCCTCTTTTCTTCTCTTCTTTCTCCCTGTTTCTCTCTTTCTCTTCTCTTTTCTCCCGGTTTCTCTCTTTCTC...

Protein

Download Protein FASTA

442 aa · LXL04_016726|LXL04_016726|OH1004|PROTEIN

MAYHSPVHTLSLGYWVWSDVEENAAEVGGENGVAGGEHRPHGRRRPLRVVVHRSRNGQERLVAPLFFSSFSLFLSFSSLFSRFLSFSHTPQFFFVLLVRWRVMWVDVGIPTPCPYLIALGANSRQEDSRRSLQLSFDDDQTLDVSTIRCMNCAHEVFDEMLKRGFKRNYKFLKSIVPFKLFLKKLLMIAPFKKSSQSKKRVDHGWTLGKQYKLGMVMSFLTGTTAEATSPNSLIQSVQSGTDANSATATTSTMESMLSLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016726`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016726

Location Chr03:132215090-132220250 (+)

Description Similar to AMSH3: AMSH-like ubiquitin thioesterase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16144`	Zinc metalloprotease that cleaves 'Lys-48'- and 'Lys-63'- linked polyubiquitin chains, but is not implicated in protein degradation by the 26S proteasome, deneddylation, or desumoylation.	The deubiquitinating enzyme AMSH3 is required for intracellular trafficking and vacuole biogenesis in Arabidopsis thaliana.2010 · DOI: 10.1105/tpc.110.075952
`At1g48790`	Zinc metalloprotease that cleaves 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.	No verified direct reference in this release
`At1g10600`	Zinc metalloprotease that cleaves 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016726 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006508 proteolysis Biological Process

GO:0006897 endocytosis Biological Process

GO:0007033 vacuole organization Biological Process

GO:0007259 cell surface receptor signaling pathway via JAK-STAT Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0015031 protein transport Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0032511 late endosome to vacuole transport via multivesicular body sorting pathway Biological Process

GO:0044090 positive regulation of vacuole organization Biological Process

GO:0046580 negative regulation of Ras protein signal transduction Biological Process

GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction Biological Process

KEGG gene cross-reference

ath:AT1G10600

ath:AT1G48790

dre:797422

hsa:10617

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.650

Rank 1 · LXL04_016726 · OH-1004

Cytoplasm0.260

Rank 2 · LXL04_016726 · OH-1004

Mitochondrion0.075

Rank 3 · LXL04_016726 · OH-1004

Cell membrane0.061

Rank 4 · LXL04_016726 · OH-1004

Endoplasmic reticulum0.053

Rank 5 · LXL04_016726 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5PNU3`	Arabidopsis thaliana	AMSH-like ubiquitin thioesterase 3	48.069%	Swiss-Prot	weak database homology
`Q8VYB5`	Arabidopsis thaliana	AMSH-like ubiquitin thioesterase 1	43.820%	Swiss-Prot	weak database homology
`Q6NKP9`	Arabidopsis thaliana	AMSH-like ubiquitin thioesterase 2	34.646%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card