LXL04_016664 | RubberDandelionOmics

Gene overview

LXL04_016664

Reference: OH-1004 Chr: Chr03 Coordinates: 130385702-130391884 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1036 bp · LXL04_016664|LXL04_016664|OH1004|cDNA

atggcGTTTGCAACAGCAATAACTTCATGTCCCCATCTTCATTTCCCAAAAAGACTTTCAGTAACTCAACAAAAGATCAGATGTTCTTCAACCACATCATCACTCTCCACCAATTTTGACCTTAAAACATATTGGTCAACTCTAAGAGAAGAAATCAATCAGAAGCTTGACGAAGCTATACCTGTTCAGTACCCATCTCAGATCTATGAATTCATGCGTTACTCTGTTCTTGCAGAAGGAGCAAAAAGAGCACAACCGGT...

CDS

Download CDS FASTA

1029 bp · LXL04_016664|LXL04_016664|OH1004|CDS

ATGGCGTTTGCAACAGCAATAACTTCATGTCCCCATCTTCATTTCCCAAAAAGACTTTCAGTAACTCAACAAAAGATCAGATGTTCTTCAACCACATCATCACTCTCCACCAATTTTGACCTTAAAACATATTGGTCAACTCTAAGAGAAGAAATCAATCAGAAGCTTGACGAAGCTATACCTGTTCAGTACCCATCTCAGATCTATGAATTCATGCGTTACTCTGTTCTTGCAGAAGGAGCAAAAAGAGCACAACCGGT...

Protein

Download Protein FASTA

342 aa · LXL04_016664|LXL04_016664|OH1004|PROTEIN

MAFATAITSCPHLHFPKRLSVTQQKIRCSSTTSSLSTNFDLKTYWSTLREEINQKLDEAIPVQYPSQIYEFMRYSVLAEGAKRAQPVMCVAAYELLGGNRLAAFPTACALEVVHVASLIHDYLPCMDDDPSRHGQPSNHTVYDSFYCQEENPLQITKHLPLQDVPIYEIESFTSQPSHLQGVDNSVCALEWLKSQEVVPVLKSQRLVKPKQKGTKVYAKGIKSLIKKFAKLDIKSECKALVVRSNKSRAIVVKRKGSRAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016664`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016664

Location Chr03:130385702-130391884 (+)

Description Similar to GGR: Heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38460`	Heterodimeric geranyl(geranyl)-diphosphate (GPP) synthase small subunit.	No verified direct reference in this release
`At4g36810`	Heterodimeric geranyl(geranyl)-diphosphate (GPP) synthase large subunit.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016664 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006720 isoprenoid metabolic process Biological Process

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0033384 geranyl diphosphate biosynthetic process Biological Process

GO:0033386 geranylgeranyl diphosphate biosynthetic process Biological Process

GO:0043693 monoterpene biosynthetic process Biological Process

GO:0045337 farnesyl diphosphate biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009509 chromoplast Cellular Component

GO:0009513 etioplast Cellular Component

KEGG gene cross-reference

ath:AT4G36810

ath:AT4G38460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.865

Rank 1 · LXL04_016664 · OH-1004

Mitochondrion0.122

Rank 2 · LXL04_016664 · OH-1004

Nucleus0.053

Rank 3 · LXL04_016664 · OH-1004

Cytoplasm0.052

Rank 4 · LXL04_016664 · OH-1004

Cell membrane0.020

Rank 5 · LXL04_016664 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00348.23polyprenyl_synt67-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016664	`PF00348.23`	polyprenyl_synt	67	143	7.2e-09	35.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39108`	Arabidopsis thaliana	Heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic	71.642%	Swiss-Prot	weak database homology
`P34802`	Arabidopsis thaliana	Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic	51.887%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card