LXL04_016655 | RubberDandelionOmics

Gene overview

LXL04_016655

Reference: OH-1004 Chr: Chr03 Coordinates: 130152455-130153822 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

714 bp · LXL04_016655|LXL04_016655|OH1004|cDNA

ATGGCGATGGCGTATGCAACCTCGTCGTCTCAGTTGTTCGGAGCATCACAAAATAACAGGTCTCCACTTCTCGTCGGGTTTTCAACAATGCCAGCATCAGCCTCCTCTCTTAAGCATATCATCGGAGCTCGAACCACTCGGAACTTTCAGATTCGTTGCGAAGAACAGAAAGTTCAACAACGAAACCTTGCACCTGTTGAGCAACGTTGGATGTTTACCGATTCAGATTTTACAGGACCGGATGTATGGAACAAAACATG...

CDS

Download CDS FASTA

714 bp · LXL04_016655|LXL04_016655|OH1004|CDS

ATGGCGATGGCGTATGCAACCTCGTCGTCTCAGTTGTTCGGAGCATCACAAAATAACAGGTCTCCACTTCTCGTCGGGTTTTCAACAATGCCAGCATCAGCCTCCTCTCTTAAGCATATCATCGGAGCTCGAACCACTCGGAACTTTCAGATTCGTTGCGAAGAACAGAAAGTTCAACAACGAAACCTTGCACCTGTTGAGCAACGTTGGATGTTTACCGATTCAGATTTTACAGGACCGGATGTATGGAACAAAACATG...

Protein

Download Protein FASTA

237 aa · LXL04_016655|LXL04_016655|OH1004|PROTEIN

MAMAYATSSSQLFGASQNNRSPLLVGFSTMPASASSLKHIIGARTTRNFQIRCEEQKVQQRNLAPVEQRWMFTDSDFTGPDVWNKTWYPKAEDHVNTEKTWYVVDATDKILGRLASAIAVHIRGKNLATYTPSVDMGAFVIVVNAEKVAVSGKKRTQKLYRRHSGRPGGMTVETFDQLQQRIPERIVEHAVRGMLPKGRLGRDLFTHLKVYVGPDHPHQAQKPIDLPIRDKRIQKQT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016655`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016655

Location Chr03:130152455-130153822 (-)

Description Similar to RPL13: 50S ribosomal protein L13, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78630`	Large ribosomal subunit protein uL13c.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016655 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ana:all4188

ath:AT1G78630

ava:Ava_0718

cyn:Cyan7425_1319

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.545

Rank 1 · LXL04_016655 · OH-1004

Mitochondrion0.405

Rank 2 · LXL04_016655 · OH-1004

Nucleus0.022

Rank 3 · LXL04_016655 · OH-1004

Cytoplasm0.018

Rank 4 · LXL04_016655 · OH-1004

Extracellular0.005

Rank 5 · LXL04_016655 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00572.25Ribosomal_L1399-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016655	`PF00572.25`	Ribosomal_L13	99	217	3.2e-44	150.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYL9`	Arabidopsis thaliana	Large ribosomal subunit protein uL13c	75.115%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card