LXL04_016653 | RubberDandelionOmics

Gene overview

LXL04_016653

Reference: OH-1004 Chr: Chr03 Coordinates: 130146504-130148252 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

570 bp · LXL04_016653|LXL04_016653|OH1004|cDNA

ATGTTGGTAGATTCGATGCGATCAAGAAACATCAATGTAGTTGTAGAGGTTTTTTCTCGCTTCACCCGCTGCTTACCTCTTTCTTATCATCATATACCCAATATTCATAAACTTTTGGTTGGTCCAACGACGATTCCGCCACTGGCAACGACAAATTCACAGTTCAAGAAAATATCTCGATGGCATGATGATGATTTGATTAAGATAGAACGGATTTCATGGATACTTAGTCCTTCATCTTCTCTTCCAAATGATGATTC...

CDS

Download CDS FASTA

570 bp · LXL04_016653|LXL04_016653|OH1004|CDS

ATGTTGGTAGATTCGATGCGATCAAGAAACATCAATGTAGTTGTAGAGGTTTTTTCTCGCTTCACCCGCTGCTTACCTCTTTCTTATCATCATATACCCAATATTCATAAACTTTTGGTTGGTCCAACGACGATTCCGCCACTGGCAACGACAAATTCACAGTTCAAGAAAATATCTCGATGGCATGATGATGATTTGATTAAGATAGAACGGATTTCATGGATACTTAGTCCTTCATCTTCTCTTCCAAATGATGATTC...

Protein

Download Protein FASTA

189 aa · LXL04_016653|LXL04_016653|OH1004|PROTEIN

MLVDSMRSRNINVVVEVFSRFTRCLPLSYHHIPNIHKLLVGPTTIPPLATTNSQFKKISRWHDDDLIKIERISWILSPSSSLPNDDSLRVSKEEDPENWHVQVFRSIDFGSLKGFPKAAQVADSQMKRGVMKSLGMYVKGYYIIIIGNHQNSFFQGYVVSVYEKKFYFFLLFALVHFQSLSKGCINYGN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016653`
TK1151 ID	TkA02G114460
OH-1004 ID	LXL04_016653
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 91.534 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016653

Location Chr03:130146504-130148252 (-)

Description Similar to PLDDELTA: Phospholipase D delta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35790`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	Involvement of a novel Arabidopsis phospholipase D, AtPLDdelta, in dehydration-inducible accumulation of phosphatidic acid in stress signalling.2001 · DOI: 10.1046/j.1365-313x.2001.01060.x Kinetic analysis of Arabidopsis phospholipase Ddelta. Substrate preference and mechanism of activation by Ca2+ and phosphatidylinositol 4,5-biphosphate.2002 · DOI: 10.1074/jbc.m209598200
`At2g42010`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release
`At4g11850`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	Expression and characterization of Arabidopsis phospholipase Dgamma2.2006 · DOI: 10.1016/j.bbalip.2006.09.017
`At4g11840`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release
`At4g00240`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016653 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006643 membrane lipid metabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009395 phospholipid catabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010044 response to aluminum ion Biological Process

GO:0012501 programmed cell death Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0046470 phosphatidylcholine metabolic process Biological Process

GO:0046473 phosphatidic acid metabolic process Biological Process

KEGG gene cross-reference

ath:AT2G42010

ath:AT4G00240

ath:AT4G11840

ath:AT4G11850

ath:AT4G35790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.307

Rank 1 · LXL04_016653 · OH-1004

Cytoplasm0.249

Rank 2 · LXL04_016653 · OH-1004

Plastid0.176

Rank 3 · LXL04_016653 · OH-1004

Mitochondrion0.133

Rank 4 · LXL04_016653 · OH-1004

Cell membrane0.125

Rank 5 · LXL04_016653 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5Y0`	Arabidopsis thaliana	Phospholipase D delta	43.860%	Swiss-Prot	weak database homology
`P93733`	Arabidopsis thaliana	Phospholipase D beta 1	48.649%	Swiss-Prot	weak database homology
`Q9T053`	Arabidopsis thaliana	Phospholipase D gamma 1	35.644%	Swiss-Prot	weak database homology
`Q9T052`	Arabidopsis thaliana	Phospholipase D gamma 3	34.653%	Swiss-Prot	weak database homology
`O23078`	Arabidopsis thaliana	Phospholipase D beta 2	36.634%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card