LXL04_016632 | RubberDandelionOmics

Gene overview

LXL04_016632

Reference: OH-1004 Chr: Chr03 Coordinates: 129647960-129648728 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

496 bp · LXL04_016632|LXL04_016632|OH1004|cDNA

ATGCACGCAAGAACCATGAACTACAAAGTTGTATTCACCGATCATTCATTATACGGATTTGCCGACATTGGAAGCATTCACATGAACAAAATACTTCAGTTCACTTTAGCGGACGTGACTCAAGCTATCTGTGTCTCACATACGAGTAAAGAAAACACGGTTTTGAGATCAGGGTTACCTCCCGATAAGGTTTTCGTGATCCCGAATGTTGTGGATACCACCATGTTTAAGCCTGCAAGTGAAAGGGTTGTGATTCGGTT...

CDS

Download CDS FASTA

321 bp · LXL04_016632|LXL04_016632|OH1004|CDS

ATGCACGCAAGAACCATGAACTACAAAGTTGTATTCACCGATCATTCATTATACGGATTTGCCGACATTGGAAGCATTCACATGAACAAAATACTTCAGTTCACTTTAGCGGACGTGACTCAAGCTATCTGTGTCTCACATACGAGTAAAGAAAACACGGTTTTGAGATCAGGGTTACCTCCCGATAAGGTTTTCGTGATCCCGAATGTTGTGGATACCACCATGTTTAAGCCTGCAAGTGAAAGGGTTGTGATTCGGTT...

Protein

Download Protein FASTA

106 aa · LXL04_016632|LXL04_016632|OH1004|PROTEIN

MHARTMNYKVVFTDHSLYGFADIGSIHMNKILQFTLADVTQAICVSHTSKENTVLRSGLPPDKVFVIPNVVDTTMFKPASERVVIRFFHQRTKSPHLSSPPGSPLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016632`
TK1151 ID	TkA02G115760
OH-1004 ID	LXL04_016632
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 33.645 / OH-1004 33.962 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016632

Location Chr03:129647960-129648728 (+)

Description Similar to PIGA: Phosphatidylinositol N-acetylglucosaminyltransferase subunit A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45100`	Necessary for the synthesis of N-acetylglucosaminyl-phosphatidylinositol, the very early intermediate in GPI-anchor biosynthesis (Probable).	SETH1 and SETH2, two components of the glycosylphosphatidylinositol anchor biosynthetic pathway, are required for pollen germination and tube growth in Arabidopsis.2004 · DOI: 10.1105/tpc.014407

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016632 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006506 GPI anchor biosynthetic process Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:1990830 cellular response to leukemia inhibitory factor Biological Process

GO:0000506 glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0030867 rough endoplasmic reticulum membrane Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0017176 phosphatidylinositol N-acetylglucosaminyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G45100

hsa:5277

mmu:18700

spo:2540986

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.314

Rank 1 · LXL04_016632 · OH-1004

Cytoplasm0.241

Rank 2 · LXL04_016632 · OH-1004

Mitochondrion0.234

Rank 3 · LXL04_016632 · OH-1004

Nucleus0.102

Rank 4 · LXL04_016632 · OH-1004

Cell membrane0.084

Rank 5 · LXL04_016632 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08288.19PIGA1-22 aa

PF13439.13Glyco_transf_45-74 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016632	`PF08288.19`	PIGA	1	22	7.4e-07	30.5
LXL04_016632	`PF13439.13`	Glyco_transf_4	5	74	1.9e-11	45.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BX4`	Arabidopsis thaliana	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A	85.366%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card