LXL04_016591 | RubberDandelionOmics

Gene overview

LXL04_016591

Reference: OH-1004 Chr: Chr03 Coordinates: 128280241-128284669 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1353 bp · LXL04_016591|LXL04_016591|OH1004|cDNA

ATGAATACCGTTATCGGAAGGTTTACCATGAGTTACCTCCGTGTATCGTATACCCCGGCAGAGACTTCTCTTTTCCCTCCCTCCGCCCTCTCCTTCCTCGTACACAGCCGCCAGTACTGCCGGAGACGGCTGTTTAGTACCTTCCAGTGCTCTGCCTCCGCAAAGCCGAATAAGGAGAAAGTCATTGTTATATCTGGCCCTACTGGCGCCGGAAAAAGCAGGCTCGCATTAGAGCTCGCTAAAAGGCTTAATGGCGAAAT...

CDS

Download CDS FASTA

1353 bp · LXL04_016591|LXL04_016591|OH1004|CDS

ATGAATACCGTTATCGGAAGGTTTACCATGAGTTACCTCCGTGTATCGTATACCCCGGCAGAGACTTCTCTTTTCCCTCCCTCCGCCCTCTCCTTCCTCGTACACAGCCGCCAGTACTGCCGGAGACGGCTGTTTAGTACCTTCCAGTGCTCTGCCTCCGCAAAGCCGAATAAGGAGAAAGTCATTGTTATATCTGGCCCTACTGGCGCCGGAAAAAGCAGGCTCGCATTAGAGCTCGCTAAAAGGCTTAATGGCGAAAT...

Protein

Download Protein FASTA

450 aa · LXL04_016591|LXL04_016591|OH1004|PROTEIN

MNTVIGRFTMSYLRVSYTPAETSLFPPSALSFLVHSRQYCRRRLFSTFQCSASAKPNKEKVIVISGPTGAGKSRLALELAKRLNGEIISADSVQVYQGLDVGSAKPSLSERHEVPHHLIDILHPSEDYSAGTFYDDGRQATKDILKRGRVPIVTGGTGLYLRWFIYGKPNVPKPTPEIILEVRSMLANFERTYDWDSAVKLVAKSGDPTAESLPVNDWYRLYRKLEIIKSSGLPASSFSVPYDSFKEQTGSKSTDLDLDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016591`
TK1151 ID	TkAUNG039350
OH-1004 ID	LXL04_016591
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	95.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016591

Location Chr03:128280241-128284669 (-)

Description Similar to IPT9: tRNA dimethylallyltransferase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20040`	Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016591 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006400 tRNA modification Biological Process

GO:0009691 cytokinin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0052381 tRNA dimethylallyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G20040

gbm:Gbem_0979

pcu:PC_RS05990

ppd:Ppro_2963

xft:PD_0067

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.846

Rank 1 · LXL04_016591 · OH-1004

Mitochondrion0.203

Rank 2 · LXL04_016591 · OH-1004

Cytoplasm0.040

Rank 3 · LXL04_016591 · OH-1004

Nucleus0.029

Rank 4 · LXL04_016591 · OH-1004

Peroxisome0.015

Rank 5 · LXL04_016591 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01745.23IPT60-110 aa

PF01715.24IPPT94-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016591	`PF01745.23`	IPT	60	110	1.9e-07	31.4
LXL04_016591	`PF01715.24`	IPPT	94	363	1.7e-50	172.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5J6`	Arabidopsis thaliana	tRNA dimethylallyltransferase 9	60.046%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card