LXL04_016432 | RubberDandelionOmics

Gene overview

LXL04_016432

Reference: OH-1004 Chr: Chr03 Coordinates: 123207563-123208656 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

714 bp · LXL04_016432|LXL04_016432|OH1004|cDNA

ATGAAGAGGTGTGAGTTGTGCAGCCATTTTGCCCGGATGTACTGTGAATCAGATAACGCAAGCCTGTGTTACGACTGCGATCAAAACATTCACTCGGCCAATTTTCTAGTAGCCAAACACTCCCGAACCCTCCTCTGCCATAAATGTCAATCTCCGACTCCCTGGAGCGCTTCCGGGCTTAATCTCGGTCGCACCGCCTCCGTTTGTGTTAACTGTCTTGACGAAAATCCATCTCAACGGCGAGTGTTGCAGGAAGGTGA...

CDS

Download CDS FASTA

714 bp · LXL04_016432|LXL04_016432|OH1004|CDS

ATGAAGAGGTGTGAGTTGTGCAGCCATTTTGCCCGGATGTACTGTGAATCAGATAACGCAAGCCTGTGTTACGACTGCGATCAAAACATTCACTCGGCCAATTTTCTAGTAGCCAAACACTCCCGAACCCTCCTCTGCCATAAATGTCAATCTCCGACTCCCTGGAGCGCTTCCGGGCTTAATCTCGGTCGCACCGCCTCCGTTTGTGTTAACTGTCTTGACGAAAATCCATCTCAACGGCGAGTGTTGCAGGAAGGTGA...

Protein

Download Protein FASTA

237 aa · LXL04_016432|LXL04_016432|OH1004|PROTEIN

MKRCELCSHFARMYCESDNASLCYDCDQNIHSANFLVAKHSRTLLCHKCQSPTPWSASGLNLGRTASVCVNCLDENPSQRRVLQEGEISHRGNDVVEENCAVDDEEEDGDTDDDETESSDESEDEDSDVDEDAENQVVPLSSVASLPATGSSSSEEVSSSRISSDGFRSASKRERLDLSIDSEDDTLCSSERSNRKRRTESFAGNDENSGYGWLVNFSHCLVCTVKKEATAHGSWMM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016432`
TK1151 ID	TkA02G142810
OH-1004 ID	LXL04_016432
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 95.694 / OH-1004 84.388 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016432

Location Chr03:123207563-123208656 (+)

Description Similar to MIP1B: B-box domain protein 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15250`	Putative zinc finger protein CONSTANS-LIKE 11.	No verified direct reference in this release
`At3g21890`	Developmental regulator acting by forming heterodimeric complexes, that sequester CO and CO-like (COL) proteins into non-functional complexes.	MicroProtein-Mediated Recruitment of CONSTANS into a TOPLESS Trimeric Complex Represses Flowering in Arabidopsis.2016 · DOI: 10.1371/journal.pgen.1005959
`At4g15248`	Developmental regulator acting by forming heterodimeric complexes, that sequester CO and CO-like (COL) proteins into non-functional complexes.	MicroProtein-Mediated Recruitment of CONSTANS into a TOPLESS Trimeric Complex Represses Flowering in Arabidopsis.2016 · DOI: 10.1371/journal.pgen.1005959
`At3g21150`	Repressor of light-mediated regulation of seedling development.	BBX32, an Arabidopsis B-Box protein, functions in light signaling by suppressing HY5-regulated gene expression and interacting with STH2/BBX21.2011 · DOI: 10.1104/pp.111.177139
`At5g48250`	Zinc finger protein CONSTANS-LIKE 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016432 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010224 response to UV-B Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT3G21150

ath:AT3G21890

ath:AT4G15248

ath:AT4G15250

ath:AT5G48250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.734

Rank 1 · LXL04_016432 · OH-1004

Cytoplasm0.298

Rank 2 · LXL04_016432 · OH-1004

Cell membrane0.052

Rank 3 · LXL04_016432 · OH-1004

Endoplasmic reticulum0.036

Rank 4 · LXL04_016432 · OH-1004

Mitochondrion0.033

Rank 5 · LXL04_016432 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23379`	Arabidopsis thaliana	Putative zinc finger protein CONSTANS-LIKE 11	44.156%	Swiss-Prot	weak database homology
`Q9LRM4`	Arabidopsis thaliana	B-box domain protein 31	50.980%	Swiss-Prot	weak database homology
`Q1G3I2`	Arabidopsis thaliana	B-box domain protein 30	45.763%	Swiss-Prot	weak database homology
`Q9LJB7`	Arabidopsis thaliana	B-box zinc finger protein 32	46.000%	Swiss-Prot	weak database homology
`Q9LUA9`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 10	51.020%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card