LXL04_016407 | RubberDandelionOmics

Gene overview

LXL04_016407

Reference: OH-1004 Chr: Chr03 Coordinates: 121969488-121973953 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1593 bp · LXL04_016407|LXL04_016407|OH1004|cDNA

ATGACCATCCATATCCCCTCCTCCTCGCCGGACGATCTCCGGTCACCTCTCATCTTACCTGACGCCAAAACCCACCTCGCCGGCTACCATGAACCACCCATCGAGCGCCTCTGCATCGACGACATGCTGCATAAATACTGCGGCGAGTTTGGGTATTGGCAATTCAAGCATTTCGTTCTCACGTGTATGGCTTGGGCTCTCGAGGCCTTCCACACCATGGTCATGATTTTCGCCGACCGGCAGCCGGAATGGATATGCGA...

CDS

Download CDS FASTA

1593 bp · LXL04_016407|LXL04_016407|OH1004|CDS

ATGACCATCCATATCCCCTCCTCCTCGCCGGACGATCTCCGGTCACCTCTCATCTTACCTGACGCCAAAACCCACCTCGCCGGCTACCATGAACCACCCATCGAGCGCCTCTGCATCGACGACATGCTGCATAAATACTGCGGCGAGTTTGGGTATTGGCAATTCAAGCATTTCGTTCTCACGTGTATGGCTTGGGCTCTCGAGGCCTTCCACACCATGGTCATGATTTTCGCCGACCGGCAGCCGGAATGGATATGCGA...

Protein

Download Protein FASTA

530 aa · LXL04_016407|LXL04_016407|OH1004|PROTEIN

MTIHIPSSSPDDLRSPLILPDAKTHLAGYHEPPIERLCIDDMLHKYCGEFGYWQFKHFVLTCMAWALEAFHTMVMIFADRQPEWICEPDSDCLSATDVCGLDAGTWRWDGGSGISTVAEWGLICGQKYKVGLVQALFFGGCMIGAGIFGHLSDSKLGRKGSLTVVCILNGITGLLTSLSPNYLTYVLLRFLTGFGTGGVGLCAFVLATEPVGPSKRGMAGMSTFYFFSGGIAILAGIAYVFRTWRSLYIASSIPSLLFVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016407`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016407

Location Chr03:121969488-121973953 (+)

Description Similar to OCT4: Organic cation/carnitine transporter 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20660`	High affinity carnitine transporter involved in the active cellular uptake of carnitine.	No verified direct reference in this release
`At1g73220`	High affinity carnitine transporter involved in the active cellular uptake of carnitine.	No verified direct reference in this release
`At1g16390`	High affinity carnitine transporter involved in the active cellular uptake of carnitine.	No verified direct reference in this release
`At1g79360`	High affinity carnitine transporter involved in the active cellular uptake of carnitine.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016407 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0010150 leaf senescence Biological Process

GO:0015839 cadaverine transport Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0015226 carnitine transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G16390

ath:AT1G73220

ath:AT1G79360

ath:AT3G20660

xla:379308

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.335

Rank 1 · LXL04_016407 · OH-1004

Cell membrane0.314

Rank 2 · LXL04_016407 · OH-1004

Endoplasmic reticulum0.135

Rank 3 · LXL04_016407 · OH-1004

Cytoplasm0.103

Rank 4 · LXL04_016407 · OH-1004

Golgi apparatus0.090

Rank 5 · LXL04_016407 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083.31Sugar_tr128-516 aa

PF07690.22MFS_1130-478 aa

PF07690.22MFS_1359-508 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016407	`PF00083.31`	Sugar_tr	128	516	6.8e-33	114.9
LXL04_016407	`PF07690.22`	MFS_1	130	478	3.8e-22	79.4
LXL04_016407	`PF07690.22`	MFS_1	359	508	3.8e-22	79.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHQ6`	Arabidopsis thaliana	Organic cation/carnitine transporter 4	69.098%	Swiss-Prot	strong database homology
`Q9CAT6`	Arabidopsis thaliana	Organic cation/carnitine transporter 1	35.178%	Swiss-Prot	moderate database homology
`Q9SA38`	Arabidopsis thaliana	Organic cation/carnitine transporter 3	33.981%	Swiss-Prot	moderate database homology
`O64515`	Arabidopsis thaliana	Organic cation/carnitine transporter 2	34.269%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card