LXL04_016362 | RubberDandelionOmics

Gene overview

LXL04_016362

Reference: OH-1004 Chr: Chr03 Coordinates: 120275307-120277567 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1245 bp · LXL04_016362|LXL04_016362|OH1004|cDNA

ATGGCGAAAGGAGGAAGCGGGCAAAACCTTCCGGCAGATGTTACCCAGTTGATTGACCAATTGGAGCGTCACTGCCTAGCTCCCGATGGATCTCTCGTCTCCAAATCTGTATACAACGATCTCCAACTTGCGCGAGAGGAAATGTCGAGAGAAAGACTACGTTATCTGGAAGCCATGGCTATATACTGTGAAGCAATTGGTATGGTTGAAGATTATCAACAAGCTATTTCCGTTGCCAATTTAGGAGGCATCCGAGACAC...

CDS

Download CDS FASTA

1245 bp · LXL04_016362|LXL04_016362|OH1004|CDS

ATGGCGAAAGGAGGAAGCGGGCAAAACCTTCCGGCAGATGTTACCCAGTTGATTGACCAATTGGAGCGTCACTGCCTAGCTCCCGATGGATCTCTCGTCTCCAAATCTGTATACAACGATCTCCAACTTGCGCGAGAGGAAATGTCGAGAGAAAGACTACGTTATCTGGAAGCCATGGCTATATACTGTGAAGCAATTGGTATGGTTGAAGATTATCAACAAGCTATTTCCGTTGCCAATTTAGGAGGCATCCGAGACAC...

Protein

Download Protein FASTA

414 aa · LXL04_016362|LXL04_016362|OH1004|PROTEIN

MAKGGSGQNLPADVTQLIDQLERHCLAPDGSLVSKSVYNDLQLAREEMSRERLRYLEAMAIYCEAIGMVEDYQQAISVANLGGIRDTQGSHSNLGLKNSPQVYEALEHRLVVAEAAQRLRLPLISKDGEVHEEEIEKWSGLSRGSPDSTSTSITITSNSSNYTDSVDPGVGGVPNRFLGITPGYLWQSQVQHAPLPMDVGEYQMPLLREIEIRLKTKCDKLADAFIDDLDSSTGSQSSSSRLPERVKLMIEEIEREETAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016362`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016362

Location Chr03:120275307-120277567 (+)

Description Similar to AUG4: AUGMIN subunit 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50710`	Involved in microtubules reorganization during spindle and phragmoplast development.	Characterization of the Arabidopsis augmin complex uncovers its critical function in the assembly of the acentrosomal spindle and phragmoplast microtubule arrays.2012 · DOI: 10.1105/tpc.112.096610

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016362 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007098 centrosome cycle Biological Process

GO:0010968 regulation of microtubule nucleation Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005813 centrosome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005876 spindle microtubule Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0070652 HAUS complex Cellular Component

GO:1990498 mitotic spindle microtubule Cellular Component

GO:0051011 microtubule minus-end binding Molecular Function

KEGG gene cross-reference

ath:AT1G50710

hsa:54930

mmu:219072

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.542

Rank 1 · LXL04_016362 · OH-1004

Nucleus0.341

Rank 2 · LXL04_016362 · OH-1004

Golgi apparatus0.102

Rank 3 · LXL04_016362 · OH-1004

Cell membrane0.077

Rank 4 · LXL04_016362 · OH-1004

Lysosome / Vacuole0.077

Rank 5 · LXL04_016362 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14735.12HAUS4166-406 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016362	`PF14735.12`	HAUS4	166	406	1.1e-72	245.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYM3`	Arabidopsis thaliana	AUGMIN subunit 4	72.143%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card