Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2136 bp · LXL04_016335|LXL04_016335|OH1004|cDNA
ATGATTCGTTCTGATTTTAGAGTACACATTTTCTATAAAGCTGAAGCAATTTCATATTCCATTCAACACGATTTCTCCAACTGTCCTTTCCACACTCATCGTCTACTAGCAGTTCCTGCAACAATGGCGTACATAAACAACACCATGGTTCAAGTTGAAAATGATACCACAACAACCGACCACGGCGAGGTAATCCTTCCTCTTACCGACAACCACAAACCGCTGTTTCCGCCTATCGTTTCATCTTACAACGAAAAAAT...
2136 bp · LXL04_016335|LXL04_016335|OH1004|CDS
ATGATTCGTTCTGATTTTAGAGTACACATTTTCTATAAAGCTGAAGCAATTTCATATTCCATTCAACACGATTTCTCCAACTGTCCTTTCCACACTCATCGTCTACTAGCAGTTCCTGCAACAATGGCGTACATAAACAACACCATGGTTCAAGTTGAAAATGATACCACAACAACCGACCACGGCGAGGTAATCCTTCCTCTTACCGACAACCACAAACCGCTGTTTCCGCCTATCGTTTCATCTTACAACGAAAAAAT...
Protein
Download Protein FASTA711 aa · LXL04_016335|LXL04_016335|OH1004|PROTEIN
MIRSDFRVHIFYKAEAISYSIQHDFSNCPFHTHRLLAVPATMAYINNTMVQVENDTTTTDHGEVILPLTDNHKPLFPPIVSSYNEKIRPILDAVDKLRRLNVAQEGIPLPAIVVVGDQSSGKSSVLESLAGISLPRGQNICTRVPLIMRLQNHSDPVPELVLEYQKKSVTIMEESQISDAIDKATVEIAGDNKGISNVPLTLVVKKSGVPNLTMIDLPGIARVAVGDQPENIYEQISDMIMEHIKPEESIILNVLAANVD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_016335 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_016335 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:119355000-119357199 (-) | |||||||||
| Description | Similar to DRP4C: Dynamin-related protein 4C | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009615 response to virus Biological Process GO:0031623 receptor internalization Biological Process GO:0034340 response to type I interferon Biological Process GO:0043330 response to exogenous dsRNA Biological Process GO:0051607 defense response to virus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005874 microtubule Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0003924 GTPase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G60500 ath:AT1G60530 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00350.30Dynamin_N112-286 aaPF01031.26Dynamin_M295-573 aaPF02212.24GED614-702 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_016335 | PF00350.30 | Dynamin_N | 112 | 286 | 5.8e-40 | 137.8 |
| LXL04_016335 | PF01031.26 | Dynamin_M | 295 | 573 | 6e-58 | 197.0 |
| LXL04_016335 | PF02212.24 | GED | 614 | 702 | 1.3e-09 | 38.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.