LXL04_016200 | RubberDandelionOmics

Gene overview

LXL04_016200

Reference: OH-1004 Chr: Chr03 Coordinates: 115009554-115011453 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · LXL04_016200|LXL04_016200|OH1004|cDNA

ATGCTCACGAATCACAAGTTATTTGTCCATCTCAACGGGGGTATTAGGTTACCAGTTACTGTTAAAGGGGCTTCAAGAAGGGTTATCTCTTTATCTTCTTCAGATATGCAGGCAACCAGCCAAAAGGAAGATGAAAATACCCCTCACTTAAAACAACTATCGTGCGTGGCAGGAGGGATAGTAGCATTAGGAAAGTTTGACGCGTTACACATAGGTCATCGTGAGCTTGCTATTCAAGCAGCAAAGGCAGGCACTCCATT...

CDS

Download CDS FASTA

981 bp · LXL04_016200|LXL04_016200|OH1004|CDS

ATGCTCACGAATCACAAGTTATTTGTCCATCTCAACGGGGGTATTAGGTTACCAGTTACTGTTAAAGGGGCTTCAAGAAGGGTTATCTCTTTATCTTCTTCAGATATGCAGGCAACCAGCCAAAAGGAAGATGAAAATACCCCTCACTTAAAACAACTATCGTGCGTGGCAGGAGGGATAGTAGCATTAGGAAAGTTTGACGCGTTACACATAGGTCATCGTGAGCTTGCTATTCAAGCAGCAAAGGCAGGCACTCCATT...

Protein

Download Protein FASTA

326 aa · LXL04_016200|LXL04_016200|OH1004|PROTEIN

MLTNHKLFVHLNGGIRLPVTVKGASRRVISLSSSDMQATSQKEDENTPHLKQLSCVAGGIVALGKFDALHIGHRELAIQAAKAGTPFLLSFTGMAEVLGWEPRAPVVAKCDRERVLSSWSACCGEVVPTELEIEFSKVRSLTPRQFVEKLSKELGVRGVVAGKNYRFGYRASGDASQLSKLCEEYGIEAYIINPVMDKKQSILATGFNDAKERGQVSSTRVRYALSEGDMEYVTELLGRHHRLILMLNDGQIWPSFSIKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016200`
TK1151 ID	TkA02G174790
OH-1004 ID	LXL04_016200
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016200

Location Chr03:115009554-115011453 (+)

Description Similar to RIBF2: FAD synthetase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08340`	Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.	Flavin nucleotide metabolism in plants: monofunctional enzymes synthesize fad in plastids.2008 · DOI: 10.1074/jbc.m803416200
`At5g23330`	Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.	Flavin nucleotide metabolism in plants: monofunctional enzymes synthesize fad in plastids.2008 · DOI: 10.1074/jbc.m803416200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0801700`	Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016200 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006747 FAD biosynthetic process Biological Process

GO:0006771 riboflavin metabolic process Biological Process

GO:0009231 riboflavin biosynthetic process Biological Process

GO:0009398 FMN biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003919 FMN adenylyltransferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008531 riboflavin kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G08340

ath:AT5G23330

buc:BU150

dosa:Os03g0801700

lmo:lmo0728

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.722

Rank 1 · LXL04_016200 · OH-1004

Cytoplasm0.262

Rank 2 · LXL04_016200 · OH-1004

Nucleus0.142

Rank 3 · LXL04_016200 · OH-1004

Mitochondrion0.109

Rank 4 · LXL04_016200 · OH-1004

Peroxisome0.048

Rank 5 · LXL04_016200 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06574.19FAD_syn58-203 aa

PF28794.1RIBF1-2_C240-325 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016200	`PF06574.19`	FAD_syn	58	203	2.5e-17	63.8
LXL04_016200	`PF28794.1`	RIBF1-2_C	240	325	1.6e-29	102.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZR0`	Arabidopsis thaliana	FAD synthetase 2, chloroplastic	62.759%	Swiss-Prot	strong database homology
`Q9FMW8`	Arabidopsis thaliana	FAD synthetase 1, chloroplastic	60.616%	Swiss-Prot	strong database homology
`Q10BX9`	Oryza sativa subsp. japonica	FAD synthetase, chloroplastic	52.795%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card