LXL04_016140 | RubberDandelionOmics

Gene overview

LXL04_016140

Reference: OH-1004 Chr: Chr03 Coordinates: 112104016-112108087 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1233 bp · LXL04_016140|LXL04_016140|OH1004|cDNA

ATGAATAAGATGAACAAAAGAGGCGGATTCAGTGCTCGTCGGCCGCTGCTTGCTGGCGAGGAGAATAACGAACAGCAGAGGCGGCGTTGGAGAAGAGGGCCGCTGGTTGCGGCGAGAAGAAGCGGTGCGCTGGCGTCGGAGGTGCGAGAGACAGCCGCCGGAGATGGGAAGGAGATTGATCGTCACAGAAGGAGGGAAATGGTGATCATAACCCAGGATATGATAAAGCAATTCCAGAGCTTGATAGAAGCAATCGACGA...

CDS

Download CDS FASTA

1233 bp · LXL04_016140|LXL04_016140|OH1004|CDS

ATGAATAAGATGAACAAAAGAGGCGGATTCAGTGCTCGTCGGCCGCTGCTTGCTGGCGAGGAGAATAACGAACAGCAGAGGCGGCGTTGGAGAAGAGGGCCGCTGGTTGCGGCGAGAAGAAGCGGTGCGCTGGCGTCGGAGGTGCGAGAGACAGCCGCCGGAGATGGGAAGGAGATTGATCGTCACAGAAGGAGGGAAATGGTGATCATAACCCAGGATATGATAAAGCAATTCCAGAGCTTGATAGAAGCAATCGACGA...

Protein

Download Protein FASTA

410 aa · LXL04_016140|LXL04_016140|OH1004|PROTEIN

MNKMNKRGGFSARRPLLAGEENNEQQRRRWRRGPLVAARRSGALASEVRETAAGDGKEIDRHRRREMVIITQDMIKQFQSLIEAIDEPIKIAYENLHQGCPTETMIRFLKARDGNIPKAHKMLVDCLNWRIENQIDKILSKPIVPVELYRSVRESQLIGMSGYTKDGRPVIAVGVGLSTYDKASIHSYVQSHIQINEFRDRVIMPSATKKYERQISTCVKVLDMTGLKLSHLNQIKLLTVISSIDDLNYPEKTDTYYIVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016140`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016140

Location Chr03:112104016-112108087 (+)

Description Similar to SFH2: Phosphatidylinositol/phosphatidylcholine transfer protein SFH2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39180`	Required for transport of secretory proteins from the Golgi complex (By similarity).	No verified direct reference in this release
`At2g21540`	Required for transport of secretory proteins from the Golgi complex (By similarity).	Identification of two phosphatidylinositol/phosphatidylcholine transfer protein genes that are predominately transcribed in the flowers of Arabidopsis thaliana.2007 · DOI: 10.1016/j.jplph.2006.03.014
`At4g36490`	Required for transport of secretory proteins from the Golgi complex (By similarity).	Identification of two phosphatidylinositol/phosphatidylcholine transfer protein genes that are predominately transcribed in the flowers of Arabidopsis thaliana.2007 · DOI: 10.1016/j.jplph.2006.03.014
`At4g34580`	Required for transport of secretory proteins from the Golgi complex (By similarity).	The Arabidopsis COW1 gene encodes a phosphatidylinositol transfer protein essential for root hair tip growth.2004 · DOI: 10.1111/j.1365-313x.2004.02245.x OsSNDP1, a Sec14-nodulin domain-containing protein, plays a critical role in root hair elongation in rice.2013 · DOI: 10.1007/s11103-013-0033-4 The COW1 locus of arabidopsis acts after RHD2, and in parallel with RHD3 and TIP1, to determine the shape, rate of elongation, and number of root hairs produced from each site of hair formation.1997 · DOI: 10.1104/pp.115.3.981
`At2g21520`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016140 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006656 phosphatidylcholine biosynthetic process Biological Process

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0009908 flower development Biological Process

GO:0009932 cell tip growth Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0015031 protein transport Biological Process

GO:0048767 root hair elongation Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G21520

ath:AT2G21540

ath:AT4G34580

ath:AT4G36490

ath:AT4G39180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.440

Rank 1 · LXL04_016140 · OH-1004

Nucleus0.265

Rank 2 · LXL04_016140 · OH-1004

Cell membrane0.204

Rank 3 · LXL04_016140 · OH-1004

Mitochondrion0.117

Rank 4 · LXL04_016140 · OH-1004

Endoplasmic reticulum0.107

Rank 5 · LXL04_016140 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03765.22CRAL_TRIO_N75-125 aa

PF00650.26CRAL_TRIO154-307 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016140	`PF03765.22`	CRAL_TRIO_N	75	125	3.8e-09	37.3
LXL04_016140	`PF00650.26`	CRAL_TRIO	154	307	7.2e-23	81.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JVA9`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH2	32.636%	Swiss-Prot	moderate database homology
`Q93ZE9`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH3	30.962%	Swiss-Prot	moderate database homology
`Q94A34`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH12	30.038%	Swiss-Prot	moderate database homology
`F4JLE5`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH1	30.213%	Swiss-Prot	moderate database homology
`F4IHJ0`	Arabidopsis thaliana	Phosphatidylinositol/phosphatidylcholine transfer protein SFH8	30.081%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card