LXL04_016114 | RubberDandelionOmics

Gene overview

LXL04_016114

Reference: OH-1004 Chr: Chr03 Coordinates: 111004516-111006479 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

327 bp · LXL04_016114|LXL04_016114|OH1004|cDNA

ATGGCGTTCTTATTCAGTTTATTCTTCAAGTTCTTCAAATCCACCAACATCCTTTTGAGTGATGATTATGAAGCAAAGATATCGGATTTTGGTCTGGCTAAGCTAATGCATGAGGGTCAAGAAACTAATGTGACACAAGGTGGGCTGTTGCTGTTTATCTCGGCTGGTAGCGTTCCTCGGGTGTATTTGCaccaggtggtggtggtggttgctgTTTTTCCTCCTCGGCTGCTGTCTGCTAAGGTTCTAAGGATGCTGGT...

CDS

Download CDS FASTA

327 bp · LXL04_016114|LXL04_016114|OH1004|CDS

ATGGCGTTCTTATTCAGTTTATTCTTCAAGTTCTTCAAATCCACCAACATCCTTTTGAGTGATGATTATGAAGCAAAGATATCGGATTTTGGTCTGGCTAAGCTAATGCATGAGGGTCAAGAAACTAATGTGACACAAGGTGGGCTGTTGCTGTTTATCTCGGCTGGTAGCGTTCCTCGGGTGTATTTGCACCAGGTGGTGGTGGTGGTTGCTGTTTTTCCTCCTCGGCTGCTGTCTGCTAAGGTTCTAAGGATGCTGGT...

Protein

Download Protein FASTA

108 aa · LXL04_016114|LXL04_016114|OH1004|PROTEIN

MAFLFSLFFKFFKSTNILLSDDYEAKISDFGLAKLMHEGQETNVTQGGLLLFISAGSVPRVYLHQVVVVVAVFPPRLLSAKVLRMLVLLPCSGVRVLPTCCSVLGLLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016114`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016114

Location Chr03:111004516-111006479 (+)

Description Similar to PBL28: Probable serine/threonine-protein kinase PBL28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24030`	May be involved in plant defense signaling.	No verified direct reference in this release
`At2g26290`	May play a role in the signal transduction pathway of osmotic stress (Probable).	An Arabidopsis thaliana root-specific kinase homolog is induced by dehydration, ABA, and NaCl.1995 · DOI: 10.1046/j.1365-313x.1995.08010037.x
`At1g61590`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g01020`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016114 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006952 defense response Biological Process

GO:0032491 detection of molecule of fungal origin Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1901141 regulation of lignin biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016301 kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G24030

ath:AT1G61590

ath:AT2G26290

ath:AT5G01020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · LXL04_016114 · OH-1004

Nucleus0.348

Rank 2 · LXL04_016114 · OH-1004

Endoplasmic reticulum0.165

Rank 3 · LXL04_016114 · OH-1004

Mitochondrion0.119

Rank 4 · LXL04_016114 · OH-1004

Cell membrane0.081

Rank 5 · LXL04_016114 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84M95`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL28	73.529%	Swiss-Prot	weak database homology
`O64842`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL12	51.020%	Swiss-Prot	weak database homology
`Q9SY91`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL15	48.980%	Swiss-Prot	weak database homology
`Q8GXZ3`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL8	48.980%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card