LXL04_016067 | RubberDandelionOmics

Gene overview

LXL04_016067

Reference: OH-1004 Chr: Chr03 Coordinates: 107062367-107065616 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1296 bp · LXL04_016067|LXL04_016067|OH1004|cDNA

ATGAAACCTAAGCTTGGTTTGAAATTATACTTAATACCCggtctcttcttcttcttcaatgaAATCGATTTCGATTTCGAGCCAGATCTAACTCCACCTCCCTCccaatttcttcttcttcttcttcttcgagtTCGTACACAGGGGGTGGTGGGTTGGAAACATGACCTAGCAGCAGGTAGAGGACGCGAGGTGGGCTGCAGCGGGCGAATCAAGGCGACGGGAAGGGAGCAAGCTCCGACAGTGGGGGGTGGGCTTTG...

CDS

Download CDS FASTA

1296 bp · LXL04_016067|LXL04_016067|OH1004|CDS

ATGAAACCTAAGCTTGGTTTGAAATTATACTTAATACCCGGTCTCTTCTTCTTCTTCAATGAAATCGATTTCGATTTCGAGCCAGATCTAACTCCACCTCCCTCCCAATTTCTTCTTCTTCTTCTTCTTCGAGTTCGTACACAGGGGGTGGTGGGTTGGAAACATGACCTAGCAGCAGGTAGAGGACGCGAGGTGGGCTGCAGCGGGCGAATCAAGGCGACGGGAAGGGAGCAAGCTCCGACAGTGGGGGGTGGGCTTTG...

Protein

Download Protein FASTA

431 aa · LXL04_016067|LXL04_016067|OH1004|PROTEIN

MKPKLGLKLYLIPGLFFFFNEIDFDFEPDLTPPPSQFLLLLLLRVRTQGVVGWKHDLAAGRGREVGCSGRIKATGREQAPTVGGGLCFSGRGRVTPGPSSLTTTEALIATDPFPFPTTEAFRHHLRSTAFARRPALHDDDDDLNPFPFPTTEAFRHHLRSTAFARRPALHDDDDLNPHCVRRKHVSPQRTDLTRVVEELVFNSLDAGATKYYFHPHDMMHMYVKCSLCVFMLNRGEALSSISDVSLLQVVTVGIRQQMVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016067`
TK1151 ID	TkA04G512580
OH-1004 ID	LXL04_016067
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.300
Protein coverage (%)	TK1151 23.423 / OH-1004 12.065 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016067

Location Chr03:107062367-107065616 (-)

Description Similar to MLH3: DNA mismatch repair protein MLH3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35520`	Involved in DNA mismatch repair (MMR), correcting insertion-deletion loops (IDLs) resulting from DNA replication, DNA damage or from recombination events between non-identical sequences during meiosis.	Reduced meiotic crossovers and delayed prophase I progression in AtMLH3-deficient Arabidopsis.2006 · DOI: 10.1038/sj.emboj.7600992 Control of meiotic recombination in Arabidopsis: role of the MutL and MutS homologues.2006 · DOI: 10.1042/bst0340542

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016067 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006298 mismatch repair Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0032300 mismatch repair complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0140664 ATP-dependent DNA damage sensor activity Molecular Function

KEGG gene cross-reference

ath:AT4G35520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.398

Rank 1 · LXL04_016067 · OH-1004

Cytoplasm0.395

Rank 2 · LXL04_016067 · OH-1004

Mitochondrion0.132

Rank 3 · LXL04_016067 · OH-1004

Endoplasmic reticulum0.102

Rank 4 · LXL04_016067 · OH-1004

Cell membrane0.096

Rank 5 · LXL04_016067 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JN26`	Arabidopsis thaliana	DNA mismatch repair protein MLH3	31.984%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card