LXL04_015861 | RubberDandelionOmics

Gene overview

LXL04_015861

Reference: OH-1004 Chr: Chr03 Coordinates: 92843355-92844070 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

641 bp · LXL04_015861|LXL04_015861|OH1004|cDNA

ATGTCGCCATTTTCAATCATATATCACCTGCTCCCACTCCCTAATTCATTCAAATCATCTACTCTCAGGAACCATCGGCAACCATGGCTTCAAAAGTCAACAGTATGCTCTTCCATCTCCTCATCGTCTTCTTCGTCGCCTCCATCGTCAGATCCTCTGATCCGGATTGTGTGTACACCATTTACGTCAGAACTGGATCAATACTTAAAGCCGGCACAGATTCCATCATGACGTTAACACTTTACGACGCTGCCGGTTAT...

CDS

Download CDS FASTA

558 bp · LXL04_015861|LXL04_015861|OH1004|CDS

ATGGCTTCAAAAGTCAACAGTATGCTCTTCCATCTCCTCATCGTCTTCTTCGTCGCCTCCATCGTCAGATCCTCTGATCCGGATTGTGTGTACACCATTTACGTCAGAACTGGATCAATACTTAAAGCCGGCACAGATTCCATCATGACGTTAACACTTTACGACGCTGCCGGTTATGGGATTAGGATCAACAATCTAGAAGCTTGGGGTGGGCTGATGGGTCCTGGGTACAACTATTTCGAGAGGAGCAATTTGGATAT...

Protein

Download Protein FASTA

185 aa · LXL04_015861|LXL04_015861|OH1004|PROTEIN

MASKVNSMLFHLLIVFFVASIVRSSDPDCVYTIYVRTGSILKAGTDSIMTLTLYDAAGYGIRINNLEAWGGLMGPGYNYFERSNLDIFSGRGPCLTGPPCEMNITSDGTGAHHGWYCNYIEVTTTGAHVPCAQQTFTVEQWLATDTSPYELTAIRNYCGSDGDGSLSADRRHVIGGSDSSLVSFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015861`
TK1151 ID	TkA02G226740
OH-1004 ID	LXL04_015861
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015861

Location Chr03:92843355-92844070 (+)

Description Similar to PLAT1: PLAT domain-containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39730`	Positive regulator of abiotic stress tolerance involved in the regulation of plant growth.	The Arabidopsis PLAT domain protein1 is critically involved in abiotic stress tolerance.2014 · DOI: 10.1371/journal.pone.0112946
`At2g22170`	Involved in response to abiotic stress.	No verified direct reference in this release
`At5g65158`	PLAT domain-containing protein 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015861 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0010287 plastoglobule Cellular Component

KEGG gene cross-reference

ath:AT2G22170

ath:AT4G39730

ath:AT5G65158

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.383

Rank 1 · LXL04_015861 · OH-1004

Cell membrane0.225

Rank 2 · LXL04_015861 · OH-1004

Endoplasmic reticulum0.128

Rank 3 · LXL04_015861 · OH-1004

Lysosome / Vacuole0.110

Rank 4 · LXL04_015861 · OH-1004

Cytoplasm0.103

Rank 5 · LXL04_015861 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06232.17ATS319-127 aa

PF01477.29PLAT31-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015861	`PF06232.17`	ATS3	19	127	4.4e-06	27.3
LXL04_015861	`PF01477.29`	PLAT	31	150	3.2e-11	44.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65660`	Arabidopsis thaliana	PLAT domain-containing protein 1	69.173%	Swiss-Prot	strong database homology
`Q9SIE7`	Arabidopsis thaliana	PLAT domain-containing protein 2	60.000%	Swiss-Prot	strong database homology
`Q2V2V3`	Arabidopsis thaliana	PLAT domain-containing protein 3	62.500%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card