LXL04_015847 | RubberDandelionOmics

Gene overview

LXL04_015847

Reference: OH-1004 Chr: Chr03 Coordinates: 91638314-91644482 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2325 bp · LXL04_015847|LXL04_015847|OH1004|cDNA

ATGGGAGGCAGAGGGAGGTCTAGAAGAACTCAAAGAAAACATTTTCGTGATGGAAGAGAAAATGTTTGGAAAGACAAGAAATCCGATTCTCAAGAAGCAGATGgaatcaacaacaacaacgaaAACGATTCCAATGGGAACAACACCAACCGGCCCACTCACTGGCAGCCATTTGCTGTTGAGAACGCTGCTTTTGATGAGTACTATAAGGAGCAAGGGGTCGTACGTCCGGAGGAATGGGATTCTTTCATTGGGTGTCT...

CDS

Download CDS FASTA

2325 bp · LXL04_015847|LXL04_015847|OH1004|CDS

ATGGGAGGCAGAGGGAGGTCTAGAAGAACTCAAAGAAAACATTTTCGTGATGGAAGAGAAAATGTTTGGAAAGACAAGAAATCCGATTCTCAAGAAGCAGATGGAATCAACAACAACAACGAAAACGATTCCAATGGGAACAACACCAACCGGCCCACTCACTGGCAGCCATTTGCTGTTGAGAACGCTGCTTTTGATGAGTACTATAAGGAGCAAGGGGTCGTACGTCCGGAGGAATGGGATTCTTTCATTGGGTGTCT...

Protein

Download Protein FASTA

774 aa · LXL04_015847|LXL04_015847|OH1004|PROTEIN

MGGRGRSRRTQRKHFRDGRENVWKDKKSDSQEADGINNNNENDSNGNNTNRPTHWQPFAVENAAFDEYYKEQGVVRPEEWDSFIGCLRKPLPAAFRINSSSQFCTDLRSQLEDEFMKALQTEGIDGNEGEGIKPLPWYPDNFAWMSSFSRMQLRKNKNLERFHEFLKQENEIGNITRQEAVSMVPPLFLDVHRDHFVLDMCAAPGSKTFQLLEMIHQASQVGELPNGMVIANDVDVQRCNLLIHQTKRMCTANLAVTNHE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015847`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_015847`
Location	Chr03:91638314-91644482 (+)
Description	Similar to NSUN2: RNA cytosine-C(5)-methyltransferase NSUN2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015847` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006397 mRNA processing Biological Process GO:0006400 tRNA modification Biological Process GO:0007286 spermatid development Biological Process GO:0008033 tRNA processing Biological Process GO:0010793 regulation of mRNA export from nucleus Biological Process GO:0030488 tRNA methylation Biological Process GO:0033313 meiotic cell cycle checkpoint signaling Biological Process GO:0036416 tRNA stabilization Biological Process GO:0051301 cell division Biological Process GO:2000736 regulation of stem cell differentiation Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component
KEGG gene cross-reference	gga:420938 hsa:54888 mmu:28114 xla:414460 xtr:548716 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.870

Rank 1 · LXL04_015847 · OH-1004

Cytoplasm0.169

Rank 2 · LXL04_015847 · OH-1004

Mitochondrion0.064

Rank 3 · LXL04_015847 · OH-1004

Cell membrane0.023

Rank 4 · LXL04_015847 · OH-1004

Endoplasmic reticulum0.013

Rank 5 · LXL04_015847 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01189.24Methyltr_RsmB-F188-373 aa

PF25376.2Pre-PUA_NSUN2554-656 aa

PF25378.2PUA_NSUN2658-748 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015847	`PF01189.24`	Methyltr_RsmB-F	188	373	2.7e-37	129.1
LXL04_015847	`PF25376.2`	Pre-PUA_NSUN2	554	656	4.5e-32	111.1
LXL04_015847	`PF25378.2`	PUA_NSUN2	658	748	1.5e-25	89.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card