LXL04_015778 | RubberDandelionOmics

Gene overview

LXL04_015778

Reference: OH-1004 Chr: Chr03 Coordinates: 84000002-84002659 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2610 bp · LXL04_015778|LXL04_015778|OH1004|cDNA

atggaagtctacatagacgatatggtggtgaagtccaaaaaagctgaggatcaccttcgtgatcttgaagatgcattcaggatcctagacgaatataacatgaagctgaacccagctaaatgccactttggagtcaaagcgggaaagttcctaggatatatggtcatgaaaagaggaattgaagctagcccagaacaaataaaagccgtgatcaacctaaaagcgccaacatcagtgaaagatattcaGAGATTtaccgg...

CDS

Download CDS FASTA

2610 bp · LXL04_015778|LXL04_015778|OH1004|CDS

ATGGAAGTCTACATAGACGATATGGTGGTGAAGTCCAAAAAAGCTGAGGATCACCTTCGTGATCTTGAAGATGCATTCAGGATCCTAGACGAATATAACATGAAGCTGAACCCAGCTAAATGCCACTTTGGAGTCAAAGCGGGAAAGTTCCTAGGATATATGGTCATGAAAAGAGGAATTGAAGCTAGCCCAGAACAAATAAAAGCCGTGATCAACCTAAAAGCGCCAACATCAGTGAAAGATATTCAGAGATTTACCGG...

Protein

Download Protein FASTA

869 aa · LXL04_015778|LXL04_015778|OH1004|PROTEIN

MEVYIDDMVVKSKKAEDHLRDLEDAFRILDEYNMKLNPAKCHFGVKAGKFLGYMVMKRGIEASPEQIKAVINLKAPTSVKDIQRFTGRIAALNRFISRSSDRCKPFYDILKKNKKFKWKEEHEKAFQELKTYLSTPPLLVKPTDAEPLILYLAVSSHTVSAVLVKDFEGDQHPVYYVSKSLLDPETRYSHLEKLILALVMASTKLRHYFETHPIHEKTNYPIKSVIRKPEMSGRMAKWSVKLSTYNIIYEPKTAIKSQAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015778`
TK1151 ID	TkA04G494880
OH-1004 ID	LXL04_015778
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.900
Protein coverage (%)	TK1151 74.424 / OH-1004 37.169 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_015778`
Location	Chr03:84000002-84002659 (+)
Description	Similar to pol: Gag-Pol polyprotein (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015778` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0019068 virion assembly Biological Process GO:0044826 viral genome integration into host DNA Biological Process GO:0046718 symbiont entry into host cell Biological Process GO:0075713 establishment of integrated proviral latency Biological Process GO:0075732 viral penetration into host nucleus Biological Process GO:0019013 viral nucleocapsid Cellular Component GO:0020002 host cell plasma membrane Cellular Component GO:0030430 host cell cytoplasm Cellular Component
KEGG gene cross-reference	vg:1491893 vg:37627274 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.611

Rank 1 · LXL04_015778 · OH-1004

Nucleus0.193

Rank 2 · LXL04_015778 · OH-1004

Mitochondrion0.167

Rank 3 · LXL04_015778 · OH-1004

Cell membrane0.051

Rank 4 · LXL04_015778 · OH-1004

Plastid0.038

Rank 5 · LXL04_015778 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078.33RVT_13-54 aa

PF17919.8RT_RNaseH_2118-214 aa

PF17917.8RT_RNaseH146-245 aa

PF13456.13RVT_3299-412 aa

PF17921.8Integrase_H2C2512-567 aa

PF00665.33rve585-681 aa

PF29688.1TnsB_C643-702 aa

PF31073.1DUF8803804-868 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015778	`PF00078.33`	RVT_1	3	54	2.9e-09	37.8
LXL04_015778	`PF17919.8`	RT_RNaseH_2	118	214	1.3e-22	80.4
LXL04_015778	`PF17917.8`	RT_RNaseH	146	245	2.7e-17	63.6
LXL04_015778	`PF13456.13`	RVT_3	299	412	1.9e-17	64.1
LXL04_015778	`PF17921.8`	Integrase_H2C2	512	567	4.7e-11	43.4
LXL04_015778	`PF00665.33`	rve	585	681	1.4e-16	61.3
LXL04_015778	`PF29688.1`	TnsB_C	643	702	2.6e-07	31.2
LXL04_015778	`PF31073.1`	DUF8803	804	868	1.6e-22	79.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card