LXL04_015767 | RubberDandelionOmics

Gene overview

LXL04_015767

Reference: OH-1004 Chr: Chr03 Coordinates: 83487602-83489838 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · LXL04_015767|LXL04_015767|OH1004|cDNA

ATGATGGTGTGTGGTGATGGTCGTAGCGGTGTGGTGCGACGGTGGTTGAGAAATGACTACCACTGGTGTGTGGTGGGAGGTGTTCCTGGTGGACGTTACAGGGCCAACGACATTGAGCAATTGAGATTTGTCTGTCTTCTTAGCCGAATCCAGCAGCTCAAGATATCGAAGCATCACGTGTTAATGTTATTGACGAAGCAATTGAATACTCCACTTGAAGAAATTGATCCTGAAATTGCCGACATTATTGAGCTTGAAAA...

CDS

Download CDS FASTA

486 bp · LXL04_015767|LXL04_015767|OH1004|CDS

ATGATGGTGTGTGGTGATGGTCGTAGCGGTGTGGTGCGACGGTGGTTGAGAAATGACTACCACTGGTGTGTGGTGGGAGGTGTTCCTGGTGGACGTTACAGGGCCAACGACATTGAGCAATTGAGATTTGTCTGTCTTCTTAGCCGAATCCAGCAGCTCAAGATATCGAAGCATCACGTGTTAATGTTATTGACGAAGCAATTGAATACTCCACTTGAAGAAATTGATCCTGAAATTGCCGACATTATTGAGCTTGAAAA...

Protein

Download Protein FASTA

161 aa · LXL04_015767|LXL04_015767|OH1004|PROTEIN

MMVCGDGRSGVVRRWLRNDYHWCVVGGVPGGRYRANDIEQLRFVCLLSRIQQLKISKHHVLMLLTKQLNTPLEEIDPEIADIIELEKARQWKTDTKKISVVSIFFETMPYRLDETTGYIDYDQMEKSAVLFRPKLIVAGASAYARVYDYARKSISSPEIDF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015767`
TK1151 ID	TkA02G288340
OH-1004 ID	LXL04_015767
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 99.379 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015767

Location Chr03:83487602-83489838 (-)

Description Similar to SHM2: Serine hydroxymethyltransferase 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26780`	Functions outside the photorespiratory pathway in catalyzing the interconversion of serine and glycine with the conversion of tetrahydrofolate (THF) into 5,10-methylene-THF.	The photorespiratory Arabidopsis shm1 mutant is deficient in SHM1.2006 · DOI: 10.1104/pp.105.071399 The presequence of Arabidopsis serine hydroxymethyltransferase SHM2 selectively prevents import into mesophyll mitochondria.2011 · DOI: 10.1104/pp.111.184564
`At4g37930`	Functions in the photorespiratory pathway in catalyzing the interconversion of serine and glycine.	Arabidopsis SHMT1, a serine hydroxymethyltransferase that functions in the photorespiratory pathway influences resistance to biotic and abiotic stress.2005 · DOI: 10.1111/j.1365-313x.2004.02311.x The photorespiratory Arabidopsis shm1 mutant is deficient in SHM1.2006 · DOI: 10.1104/pp.105.071399 The presequence of Arabidopsis serine hydroxymethyltransferase SHM2 selectively prevents import into mesophyll mitochondria.2011 · DOI: 10.1104/pp.111.184564 Ubiquitin-specific protease16 modulates salt tolerance in Arabidopsis by regulating Na(+)/H(+) antiport activity and serine hydroxymethyltransferase stability.2012 · DOI: 10.1105/tpc.112.106393

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015767 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006544 glycine metabolic process Biological Process

GO:0006563 L-serine metabolic process Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009853 photorespiration Biological Process

GO:0019264 glycine biosynthetic process from L-serine Biological Process

GO:0035999 tetrahydrofolate interconversion Biological Process

GO:0046653 tetrahydrofolate metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT4G37930

ath:AT5G26780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.415

Rank 1 · LXL04_015767 · OH-1004

Cytoplasm0.362

Rank 2 · LXL04_015767 · OH-1004

Mitochondrion0.173

Rank 3 · LXL04_015767 · OH-1004

Cell membrane0.079

Rank 4 · LXL04_015767 · OH-1004

Endoplasmic reticulum0.057

Rank 5 · LXL04_015767 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00464.26SHMT92-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015767	`PF00464.26`	SHMT	92	151	1.4e-23	83.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94C74`	Arabidopsis thaliana	Serine hydroxymethyltransferase 2, mitochondrial	90.164%	Swiss-Prot	weak database homology
`Q9SZJ5`	Arabidopsis thaliana	Serine hydroxymethyltransferase 1, mitochondrial	90.164%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card