LXL04_015672 | RubberDandelionOmics

Gene overview

LXL04_015672

Reference: OH-1004 Chr: Chr03 Coordinates: 79778578-79779905 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

864 bp · LXL04_015672|LXL04_015672|OH1004|cDNA

ATGGAGCTCCCACTAACAACAATCAGTATCTCTCTAAGACTATCTTCCCCCTCCCTCTACCCTAAACGGTCAATCGATGGGTACTTTAAATACCATTGCCGGTTCCCTTATAAAAAATTACAACTTGGTAGTAATTCGAAACGCCCCCGTCGAATCAAATCGAGTTTCGACAAACATTCTTCTTCGTCTACACAAATATTGAACCGAGAGAGGGCTTTGAATACATGGGAAGACGCTGAGATTGTGGAAGCCATCGGCGT...

CDS

Download CDS FASTA

864 bp · LXL04_015672|LXL04_015672|OH1004|CDS

ATGGAGCTCCCACTAACAACAATCAGTATCTCTCTAAGACTATCTTCCCCCTCCCTCTACCCTAAACGGTCAATCGATGGGTACTTTAAATACCATTGCCGGTTCCCTTATAAAAAATTACAACTTGGTAGTAATTCGAAACGCCCCCGTCGAATCAAATCGAGTTTCGACAAACATTCTTCTTCGTCTACACAAATATTGAACCGAGAGAGGGCTTTGAATACATGGGAAGACGCTGAGATTGTGGAAGCCATCGGCGT...

Protein

Download Protein FASTA

287 aa · LXL04_015672|LXL04_015672|OH1004|PROTEIN

MELPLTTISISLRLSSPSLYPKRSIDGYFKYHCRFPYKKLQLGSNSKRPRRIKSSFDKHSSSSTQILNRERALNTWEDAEIVEAIGVGSRKDVVLDFCLSSSSLSRRLRFWNIIVEETFKVQLQQRLLGDGELMLIFIDIPLLYSVVEINICLYHLLDLIFHFADITKTFVEESAAMKSHSKAVAGASYGSDLNAVHDIFEAIKLANGFVVTIILKPFRFEGQRRQNEVKDLMYKLEGFTYFCIMIDAYALLEKDLVTLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015672`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015672

Location Chr03:79778578-79779905 (-)

Description Similar to ARC3: Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75010`	Together with MIND1 and MCD1, regulates FtsZ ring positioning in chloroplasts in an ARC6-dependent manner.	The distinctive roles of five different ARC genes in the chloroplast division process in Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00500.x ARC3, a chloroplast division factor, is a chimera of prokaryotic FtsZ and part of eukaryotic phosphatidylinositol-4-phosphate 5-kinase.2004 · DOI: 10.1093/pcp/pch130 Effects of arc3, arc5 and arc6 mutations on plastid morphology and stromule formation in green and nongreen tissues of Arabidopsis thaliana.2008 · DOI: 10.1111/j.1751-1097.2008.00437.x The chloroplast min system functions differentially in two specific nongreen plastids in Arabidopsis thaliana.2013 · DOI: 10.1371/journal.pone.0071190 FtsZ1/FtsZ2 Turnover in Chloroplasts and the Role of ARC3.2015 · DOI: 10.1017/s1431927615000082 MCD1 Associates with FtsZ Filaments via the Membrane-Tethering Protein ARC6 to Guide Chloroplast Division.2018 · DOI: 10.1105/tpc.18.00189 ARC3 Activation by PARC6 Promotes FtsZ-Ring Remodeling at the Chloroplast Division Site.2019 · DOI: 10.1105/tpc.18.00948

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015672 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009657 plastid organization Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0098562 cytoplasmic side of membrane Cellular Component

GO:0005525 GTP binding Molecular Function

KEGG gene cross-reference

ath:AT1G75010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.819

Rank 1 · LXL04_015672 · OH-1004

Nucleus0.091

Rank 2 · LXL04_015672 · OH-1004

Mitochondrion0.084

Rank 3 · LXL04_015672 · OH-1004

Cytoplasm0.071

Rank 4 · LXL04_015672 · OH-1004

Cell membrane0.050

Rank 5 · LXL04_015672 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6F6B5`	Arabidopsis thaliana	Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 3, chloroplastic	37.500%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card