LXL04_015603 | RubberDandelionOmics

Gene overview

LXL04_015603

Reference: OH-1004 Chr: Chr03 Coordinates: 77378255-77379671 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1203 bp · LXL04_015603|LXL04_015603|OH1004|cDNA

GCCTGTCCCCTTCAAACGCAATTAAAGTCTCTCCTCTCTACGTTTCTCAGTCTCTTACACTCTCTCTCACTAACACCTCCTTTTTCTACGTTTACATTTCCAAATACATTACCATTATTCGATTCCTCAAACAGAATGAATATGGAAACTAATGAATTCCTTCAAGGAACATCTCCCGATCATCACCTCCAATTCTCACCGGAAAAACCTAAAACCGAGAATTTTCTCATCGACGACCTCCTCAATTTCCCCACCGACGA...

CDS

Download CDS FASTA

1068 bp · LXL04_015603|LXL04_015603|OH1004|CDS

ATGAATATGGAAACTAATGAATTCCTTCAAGGAACATCTCCCGATCATCACCTCCAATTCTCACCGGAAAAACCTAAAACCGAGAATTTTCTCATCGACGACCTCCTCAATTTCCCCACCGACGACATGGTACCTGCCGTTGCAGAAAACGGTGTTGCAGGCGCCTCCACGGATTCCTCCACCGTCGTTGACAGTTGTAATTCCCCTGTCTGTGGTGGCGCCGAACATACCTCTCCCGGAGATGCCCCTCGCCGGAGCTT...

Protein

Download Protein FASTA

355 aa · LXL04_015603|LXL04_015603|OH1004|PROTEIN

MNMETNEFLQGTSPDHHLQFSPEKPKTENFLIDDLLNFPTDDMVPAVAENGVAGASTDSSTVVDSCNSPVCGGAEHTSPGDAPRRSLTDTPFSNDLCVPYDDLAELEWLSNVVEESFSCEDLQKLQLISGIKTRPNYTSSTDPQVQPDTMNRSNNPIFNTEMAVPGKARTKRSRAAPCNWNSRLLAVSPTASGPGPTIMSSESESDITSSSIRKKIVKAGIKRKEVYDNPSHNGDGRKCLHCATDKTPQWRTGPLGPKTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015603`
TK1151 ID	TkA02G310080
OH-1004 ID	LXL04_015603
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.500
Protein coverage (%)	TK1151 88.722 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015603

Location Chr03:77378255-77379671 (+)

Description Similar to GATA12: GATA transcription factor 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25830`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At4g32890`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At3g60530`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At2g45050`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At4g36240`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015603 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071555 cell wall organization Biological Process

GO:1905177 tracheary element differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G45050

ath:AT3G60530

ath:AT4G32890

ath:AT4G36240

ath:AT5G25830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.922

Rank 1 · LXL04_015603 · OH-1004

Cytoplasm0.222

Rank 2 · LXL04_015603 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_015603 · OH-1004

Mitochondrion0.021

Rank 4 · LXL04_015603 · OH-1004

Endoplasmic reticulum0.012

Rank 5 · LXL04_015603 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00320.34GATA239-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015603	`PF00320.34`	GATA	239	273	5.4e-15	55.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P69781`	Arabidopsis thaliana	GATA transcription factor 12	55.755%	Swiss-Prot	strong database homology
`O82632`	Arabidopsis thaliana	GATA transcription factor 9	43.713%	Swiss-Prot	moderate database homology
`O49743`	Arabidopsis thaliana	GATA transcription factor 4	45.726%	Swiss-Prot	moderate database homology
`O49741`	Arabidopsis thaliana	GATA transcription factor 2	42.795%	Swiss-Prot	moderate database homology
`O65515`	Arabidopsis thaliana	GATA transcription factor 7	41.827%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card