LXL04_015541 | RubberDandelionOmics

Gene overview

LXL04_015541

Reference: OH-1004 Chr: Chr03 Coordinates: 75317788-75325219 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4473 bp · LXL04_015541|LXL04_015541|OH1004|cDNA

ATGCGTTCTAAAGCTATGGAGGTCATAAAAGGTTCGAACATTTCTGAGTTTTGGACACCATGGATGCAGCCAGGCTCGCCCTGTTTGTGGGAAATCGCCAGCATTATCCTCCAACTTGGGTTCCTTGCGGTCCTATTAATCGGCCTTTTAAAACGACTCATTGAGCCACGGTCCACCCACAAACCAAAAGCCATGACCCCCGACCGGTACCCAACCAACATCAAAACTGGTCTCTCCTACAAACTAAGTCTAGTATGCTC...

CDS

Download CDS FASTA

4473 bp · LXL04_015541|LXL04_015541|OH1004|CDS

ATGCGTTCTAAAGCTATGGAGGTCATAAAAGGTTCGAACATTTCTGAGTTTTGGACACCATGGATGCAGCCAGGCTCGCCCTGTTTGTGGGAAATCGCCAGCATTATCCTCCAACTTGGGTTCCTTGCGGTCCTATTAATCGGCCTTTTAAAACGACTCATTGAGCCACGGTCCACCCACAAACCAAAAGCCATGACCCCCGACCGGTACCCAACCAACATCAAAACTGGTCTCTCCTACAAACTAAGTCTAGTATGCTC...

Protein

Download Protein FASTA

1490 aa · LXL04_015541|LXL04_015541|OH1004|PROTEIN

MRSKAMEVIKGSNISEFWTPWMQPGSPCLWEIASIILQLGFLAVLLIGLLKRLIEPRSTHKPKAMTPDRYPTNIKTGLSYKLSLVCSILLLGTHIMVPLTFTTRNKAHCEFEIPILSSEIMQMISWVMTLIAIYLIPKRQKVDFPWIIRVWWLCTFLLTTSRFTLDVHFLVLNHGHPGLLEYIDLVSVLSSTCLLFIAIKGKTGLTVADPSAITEPFLHGNDHKKQEKLECPYGKASIFQLITFSWLNPLFVVGIKKPLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015541`
TK1151 ID	TkA02G318540
OH-1004 ID	LXL04_015541
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015541

Location Chr03:75317788-75325219 (-)

Description Similar to ABCC9: ABC transporter C family member 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60160`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At3g60970`	Pump for glutathione S-conjugates.	No verified direct reference in this release
`At1g04120`	Pump for glutathione S-conjugates.	The Arabidopsis thaliana ABC transporter AtMRP5 controls root development and stomata movement.2001 · DOI: 10.1093/emboj/20.8.1875 The plant multidrug resistance ABC transporter AtMRP5 is involved in guard cell hormonal signalling and water use.2003 · DOI: 10.1046/j.1365-313x.2003.016012.x Binding of sulfonylurea by AtMRP5, an Arabidopsis multidrug resistance-related protein that functions in salt tolerance.2004 · DOI: 10.1104/pp.103.027045 The Arabidopsis ATP-binding cassette protein AtMRP5/AtABCC5 is a high affinity inositol hexakisphosphate transporter involved in guard cell signaling and phytate storage.2009 · DOI: 10.1074/jbc.m109.030247
`At3g13080`	Pump for glutathione S-conjugates.	An ABC-transporter of Arabidopsis thaliana has both glutathione-conjugate and chlorophyll catabolite transport activity.1998 · DOI: 10.1046/j.1365-313x.1998.00076.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015541 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0009651 response to salt stress Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G04120

ath:AT3G13080

ath:AT3G60160

ath:AT3G60970

zma:100125659

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.444

Rank 1 · LXL04_015541 · OH-1004

Lysosome / Vacuole0.271

Rank 2 · LXL04_015541 · OH-1004

Cytoplasm0.173

Rank 3 · LXL04_015541 · OH-1004

Endoplasmic reticulum0.139

Rank 4 · LXL04_015541 · OH-1004

Golgi apparatus0.099

Rank 5 · LXL04_015541 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664.29ABC_membrane304-571 aa

PF00005.34ABC_tran636-770 aa

PF00664.29ABC_membrane956-1170 aa

PF00005.34ABC_tran1260-1408 aa

PF13555.13AAA_291272-1298 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015541	`PF00664.29`	ABC_membrane	304	571	1e-59	203.2
LXL04_015541	`PF00005.34`	ABC_tran	636	770	1e-47	162.9
LXL04_015541	`PF00664.29`	ABC_membrane	956	1170	1e-59	203.2
LXL04_015541	`PF00005.34`	ABC_tran	1260	1408	1e-47	162.9
LXL04_015541	`PF13555.13`	AAA_29	1272	1298	1.3e-07	32.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1C7`	Arabidopsis thaliana	ABC transporter C family member 9	62.711%	Swiss-Prot	strong database homology
`Q7FB56`	Arabidopsis thaliana	Putative ABC transporter C family member 15	67.808%	Swiss-Prot	strong database homology
`Q7GB25`	Arabidopsis thaliana	ABC transporter C family member 5	49.657%	Swiss-Prot	moderate database homology
`Q9LK64`	Arabidopsis thaliana	ABC transporter C family member 3	50.645%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card