LXL04_015494 | RubberDandelionOmics

Gene overview

LXL04_015494

Reference: OH-1004 Chr: Chr03 Coordinates: 73634783-73639132 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1266 bp · LXL04_015494|LXL04_015494|OH1004|cDNA

ATGACAATTCTTTACGCGCTTGTGGCGAGGGGATCTGTGGTTTTAGCAGAATTCAGTGGTACGCCTACGAATGCGAGCACGATTGCGAGGCAAATCCTCGAGAAAACCCCGGGAGATAATGATATGAATGTTTCTTATTCGCAAGATCGGTATATTTTTCATGTCAAACGTACCGACGGCCTTACTGCTCTCTGTATGGCGGACGACGTTGCCGGAAGGAGAATTCCTTTTGCTTTTCTTGAAGACATTCATCAAAAATT...

CDS

Download CDS FASTA

1266 bp · LXL04_015494|LXL04_015494|OH1004|CDS

ATGACAATTCTTTACGCGCTTGTGGCGAGGGGATCTGTGGTTTTAGCAGAATTCAGTGGTACGCCTACGAATGCGAGCACGATTGCGAGGCAAATCCTCGAGAAAACCCCGGGAGATAATGATATGAATGTTTCTTATTCGCAAGATCGGTATATTTTTCATGTCAAACGTACCGACGGCCTTACTGCTCTCTGTATGGCGGACGACGTTGCCGGAAGGAGAATTCCTTTTGCTTTTCTTGAAGACATTCATCAAAAATT...

Protein

Download Protein FASTA

421 aa · LXL04_015494|LXL04_015494|OH1004|PROTEIN

MTILYALVARGSVVLAEFSGTPTNASTIARQILEKTPGDNDMNVSYSQDRYIFHVKRTDGLTALCMADDVAGRRIPFAFLEDIHQKFVRTYGRAVLSAQAYGMNDEFSRVLSQQMEYYSNDPNADRINRLKGEMGQVRTVMIENIDKVLERGDRLELLVDKTNTMQTNTLRFRKQTRRYRTSVWWRNVKLTSGIGNSSSGIGMVRFRFWFRKHHLSDCLLSTPCIVCEVSIHRFWCRRFSKLFVVFTVEKSHACRIQSIK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015494`
TK1151 ID	TkA02G325940
OH-1004 ID	LXL04_015494
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015494

Location Chr03:73634783-73639132 (+)

Description Similar to VAMP711: Vesicle-associated membrane protein 711

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32150`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At5g11150`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At2g25340`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At5g22360`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At1g16300`	Involved in plastidial glycolytic pathway and plays a specific role in glycolytic energy production in non-green plastids and chloroplasts.	Plastidial glyceraldehyde-3-phosphate dehydrogenase deficiency leads to altered root development and affects the sugar and amino acid balance in Arabidopsis.2009 · DOI: 10.1104/pp.109.143701 The plastidial glyceraldehyde-3-phosphate dehydrogenase is critical for viable pollen development in Arabidopsis.2010 · DOI: 10.1104/pp.109.150458

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015494 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006006 glucose metabolic process Biological Process

GO:0006096 glycolytic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010118 stomatal movement Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0061025 membrane fusion Biological Process

GO:0080022 primary root development Biological Process

GO:0080144 intracellular amino acid homeostasis Biological Process

GO:0098876 vesicle-mediated transport to the plasma membrane Biological Process

KEGG gene cross-reference

ath:AT1G16300

ath:AT2G25340

ath:AT4G32150

ath:AT5G11150

ath:AT5G22360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.214

Rank 1 · LXL04_015494 · OH-1004

Plastid0.192

Rank 2 · LXL04_015494 · OH-1004

Endoplasmic reticulum0.182

Rank 3 · LXL04_015494 · OH-1004

Mitochondrion0.142

Rank 4 · LXL04_015494 · OH-1004

Golgi apparatus0.124

Rank 5 · LXL04_015494 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13774.14Longin15-111 aa

PF00957.28Synaptobrevin126-195 aa

PF00044.31Gp_dh_N280-375 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015494	`PF13774.14`	Longin	15	111	8.6e-25	87.5
LXL04_015494	`PF00957.28`	Synaptobrevin	126	195	1.1e-22	80.4
LXL04_015494	`PF00044.31`	Gp_dh_N	280	375	9.6e-27	93.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49377`	Arabidopsis thaliana	Vesicle-associated membrane protein 711	80.952%	Swiss-Prot	weak database homology
`Q9LFP1`	Arabidopsis thaliana	Vesicle-associated membrane protein 713	78.646%	Swiss-Prot	weak database homology
`Q9SIQ9`	Arabidopsis thaliana	Vesicle-associated membrane protein 712	78.836%	Swiss-Prot	weak database homology
`Q9FMR5`	Arabidopsis thaliana	Vesicle-associated membrane protein 714	56.545%	Swiss-Prot	weak database homology
`Q5E924`	Arabidopsis thaliana	Glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic	67.416%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card