LXL04_015466 | RubberDandelionOmics

Gene overview

LXL04_015466

Reference: OH-1004 Chr: Chr03 Coordinates: 72853450-72858332 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3380 bp · LXL04_015466|LXL04_015466|OH1004|cDNA

ATGGAGCCAGATGTCAGCATCGCCACTAGTTCCATGATCCGGATCGCCGTTATCCCGGTCGGAGAAATCCACCTGCACCTCTTCCGCAAATACGCCGGGATGCTCGACCGCCACCACAAGATCGAACTCTCAACTATCACTTCTTTCTACAAAGTAGACAAGAAATCTCCATTCCAACAGCAGCCATGGGAATCCGGTAGTTTAAGGTTCAAGTTCATTGTAGGCGGATCGCCGCCTAGTCCATGGGAGGATTTCCAATC...

CDS

Download CDS FASTA

3360 bp · LXL04_015466|LXL04_015466|OH1004|CDS

ATGGAGCCAGATGTCAGCATCGCCACTAGTTCCATGATCCGGATCGCCGTTATCCCGGTCGGAGAAATCCACCTGCACCTCTTCCGCAAATACGCCGGGATGCTCGACCGCCACCACAAGATCGAACTCTCAACTATCACTTCTTTCTACAAAGTAGACAAGAAATCTCCATTCCAACAGCAGCCATGGGAATCCGGTAGTTTAAGGTTCAAGTTCATTGTAGGCGGATCGCCGCCTAGTCCATGGGAGGATTTCCAATC...

Protein

Download Protein FASTA

1119 aa · LXL04_015466|LXL04_015466|OH1004|PROTEIN

MEPDVSIATSSMIRIAVIPVGEIHLHLFRKYAGMLDRHHKIELSTITSFYKVDKKSPFQQQPWESGSLRFKFIVGGSPPSPWEDFQSNRKIHGVIGICYCPSSPDLGSVAEQFAVACKGYASSVVQRCFVFSPGDKQLADGNNNKNKLVLFPPADQRAQEIHLQTMMQEIAASLLMEFEKWVSRPESGGIILKTPLDSQASLSSEEVIKATKRRLGRAQKTTGDYCLLAGSPVDANAHYSTALELARLTGDHFWYAGAME...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015466`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015466

Location Chr03:72853450-72858332 (+)

Description Similar to TRS120: Trafficking protein particle complex II-specific subunit 120 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11040`	Specific subunit of the TRAPP II complex, a highly conserved vesicle tethering complex that is required for the proper transport of proteins in post-Golgi trafficking pathways to the growing cell plate in mitotic active cells.	Tethering factors required for cytokinesis in Arabidopsis.2010 · DOI: 10.1104/pp.110.154286 A specific role for Arabidopsis TRAPPII in post-Golgi trafficking that is crucial for cytokinesis and cell polarity.2011 · DOI: 10.1111/j.1365-313x.2011.04681.x VAN4 encodes a putative TRS120 that is required for normal cell growth and vein development in Arabidopsis.2014 · DOI: 10.1093/pcp/pcu012

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0502200`	Specific subunit of the TRAPP II complex, a highly conserved vesicle tethering complex that is required for the proper transport of proteins in post-Golgi trafficking pathways to the growing cell plate in mitotic active cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015466 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0000919 cell plate assembly Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006901 vesicle coating Biological Process

GO:0030154 cell differentiation Biological Process

GO:0099022 vesicle tethering Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT5G11040

bta:533451

dosa:Os04g0502200

hsa:83696

mmu:76510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.520

Rank 1 · LXL04_015466 · OH-1004

Nucleus0.304

Rank 2 · LXL04_015466 · OH-1004

Golgi apparatus0.188

Rank 3 · LXL04_015466 · OH-1004

Endoplasmic reticulum0.091

Rank 4 · LXL04_015466 · OH-1004

Lysosome / Vacuole0.076

Rank 5 · LXL04_015466 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08626.17TRAPPC9-Trs1206-185 aa

PF08626.17TRAPPC9-Trs120204-269 aa

PF26251.1TPR_TRAPPC9-Trs120330-493 aa

PF26254.1Ig_TRAPPC9-Trs120_1st540-642 aa

PF26280.1Ig_TRAPPC9-Trs120_2nd691-744 aa

PF26282.1Ig_TRAPPC9-Trs120_3rd834-977 aa

PF26283.1Ig_TRAPPC9-Trs120_4th996-1115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015466	`PF08626.17`	TRAPPC9-Trs120	6	185	1.3e-31	110.7
LXL04_015466	`PF08626.17`	TRAPPC9-Trs120	204	269	1.3e-31	110.7
LXL04_015466	`PF26251.1`	TPR_TRAPPC9-Trs120	330	493	8.4e-13	49.1
LXL04_015466	`PF26254.1`	Ig_TRAPPC9-Trs120_1st	540	642	1.7e-22	80.8
LXL04_015466	`PF26280.1`	Ig_TRAPPC9-Trs120_2nd	691	744	1.7e-08	35.3
LXL04_015466	`PF26282.1`	Ig_TRAPPC9-Trs120_3rd	834	977	1.5e-11	45.2
LXL04_015466	`PF26283.1`	Ig_TRAPPC9-Trs120_4th	996	1115	1.4e-10	41.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY61`	Arabidopsis thaliana	Trafficking protein particle complex II-specific subunit 120 homolog	67.878%	Swiss-Prot	strong database homology
`Q0JBY9`	Oryza sativa subsp. japonica	Trafficking protein particle complex II-specific subunit 120 homolog	59.201%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card