LXL04_015374 | RubberDandelionOmics

Gene overview

LXL04_015374

Reference: OH-1004 Chr: Chr03 Coordinates: 69922984-69924610 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1218 bp · LXL04_015374|LXL04_015374|OH1004|cDNA

ATGGAAATCGATTCAGAATCAAATGTCAAACCATCAGAGGAAGTTGCATCATCCATGGATTCCGAAACCTCAAATCCATCAGGACTCCAATCAACCAATGAAGCAAAAGATGATATCGCCAAATCAATGGGGAATCTGCAGATAGACAAGTCTTCCTCTAGCACAACAAATTTCAAAAAGAAGCCTGTTATTATCATTGTTGTAGGAATGGCTGGAAGTGGAAAAACAACATTTCTTCATCGAACTGTATGTCATACACA...

CDS

Download CDS FASTA

1218 bp · LXL04_015374|LXL04_015374|OH1004|CDS

ATGGAAATCGATTCAGAATCAAATGTCAAACCATCAGAGGAAGTTGCATCATCCATGGATTCCGAAACCTCAAATCCATCAGGACTCCAATCAACCAATGAAGCAAAAGATGATATCGCCAAATCAATGGGGAATCTGCAGATAGACAAGTCTTCCTCTAGCACAACAAATTTCAAAAAGAAGCCTGTTATTATCATTGTTGTAGGAATGGCTGGAAGTGGAAAAACAACATTTCTTCATCGAACTGTATGTCATACACA...

Protein

Download Protein FASTA

405 aa · LXL04_015374|LXL04_015374|OH1004|PROTEIN

MEIDSESNVKPSEEVASSMDSETSNPSGLQSTNEAKDDIAKSMGNLQIDKSSSSTTNFKKKPVIIIVVGMAGSGKTTFLHRTVCHTQASNKKGYVLNLDPAVMTLPFGANIDIRDTVRYKEVMKQFNLGPNGGILTSLNLFATKFDDVIQMIERRADDLDYVLVDTPGQIEIFTWSASGAIITESFASTFPTVIAYVVDTPRAESPNTFMSNMLYACSILYKTRLPMVLVFNKTDVAHHQFALEWMEDFEVFHAALDSDH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015374`
TK1151 ID	TkA02G341330
OH-1004 ID	LXL04_015374
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015374

Location Chr03:69922984-69924610 (-)

Description Similar to QQT2: GPN-loop GTPase QQT2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21800`	Small GTPase that is essential for the correct formation of the tangential divisions in early embryos.	QQT proteins colocalize with microtubules and are essential for early embryo development in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03072.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015374 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006606 protein import into nucleus Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0007064 mitotic sister chromatid cohesion Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0051301 cell division Biological Process

GO:1990114 RNA polymerase II core complex assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005819 spindle Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005874 microtubule Cellular Component

KEGG gene cross-reference

ath:AT4G21800

ddi:DDB_G0293220

hsa:11321

sce:YJR072C

spo:2540123

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.706

Rank 1 · LXL04_015374 · OH-1004

Nucleus0.358

Rank 2 · LXL04_015374 · OH-1004

Lysosome / Vacuole0.067

Rank 3 · LXL04_015374 · OH-1004

Golgi apparatus0.067

Rank 4 · LXL04_015374 · OH-1004

Endoplasmic reticulum0.054

Rank 5 · LXL04_015374 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00009.34GTP_EFTU63-303 aa

PF02492.26cobW64-247 aa

PF03029.24ATP_bind_167-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015374	`PF00009.34`	GTP_EFTU	63	303	9.3e-06	26.1
LXL04_015374	`PF02492.26`	cobW	64	247	1.9e-06	28.3
LXL04_015374	`PF03029.24`	ATP_bind_1	67	305	4.3e-80	269.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W586`	Arabidopsis thaliana	GPN-loop GTPase QQT2	73.837%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card