LXL04_015316 | RubberDandelionOmics

Gene overview

LXL04_015316

Reference: OH-1004 Chr: Chr03 Coordinates: 68440381-68441545 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

984 bp · LXL04_015316|LXL04_015316|OH1004|cDNA

ATGTCGAGGAGAAACACCAGAGGCCCCTCGAACGGGATGATCCCCTTGATGTTATTGCAGGCCGTTAACGAGTACCGGAGGCTTGAACGTAAACCCCCCGTCACGGCGGCTATTCTTGCTGCCAACACTCTCATTTATCTACGCCCTGCCTTCCTTAATCACATCCTTCCTACAATTGACGATGTCTGGTTCAATGCTCATCTCATCGTTAAGGATAAGGATCTGAAGCGCTTCTTCTTATCTGCTTTCTATCATCTCGG...

CDS

Download CDS FASTA

984 bp · LXL04_015316|LXL04_015316|OH1004|CDS

ATGTCGAGGAGAAACACCAGAGGCCCCTCGAACGGGATGATCCCCTTGATGTTATTGCAGGCCGTTAACGAGTACCGGAGGCTTGAACGTAAACCCCCCGTCACGGCGGCTATTCTTGCTGCCAACACTCTCATTTATCTACGCCCTGCCTTCCTTAATCACATCCTTCCTACAATTGACGATGTCTGGTTCAATGCTCATCTCATCGTTAAGGATAAGGATCTGAAGCGCTTCTTCTTATCTGCTTTCTATCATCTCGG...

Protein

Download Protein FASTA

327 aa · LXL04_015316|LXL04_015316|OH1004|PROTEIN

MSRRNTRGPSNGMIPLMLLQAVNEYRRLERKPPVTAAILAANTLIYLRPAFLNHILPTIDDVWFNAHLIVKDKDLKRFFLSAFYHLGESHLVYNMISLLWKGIQLETSLGSAEFASMVAALLGLSQGITLVLAKSLLLFNYERAYYNEYAAGFSGVLFAMKVVLNSQSDGYTNLNGFVVPAKHAAWAELVLIQLLVPNVSFLGHLGGILAGIVYLRLKASYTGPSPLTKMLKGLTSLLGWPLRSLLRIWQPQQQRFSGRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015316`
TK1151 ID	TkA02G347200
OH-1004 ID	LXL04_015316
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015316

Location Chr03:68440381-68441545 (+)

Description Similar to RBL14: Rhomboid-like protein 14, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17611`	Probable rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015316 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0010954 positive regulation of protein processing Biological Process

GO:0031293 membrane protein intracellular domain proteolysis Biological Process

GO:0033619 membrane protein proteolysis Biological Process

GO:0034620 cellular response to unfolded protein Biological Process

GO:0034644 cellular response to UV Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0045732 positive regulation of protein catabolic process Biological Process

GO:0048515 spermatid differentiation Biological Process

GO:0051047 positive regulation of secretion Biological Process

GO:1904211 membrane protein proteolysis involved in retrograde protein transport, ER to cytosol Biological Process

KEGG gene cross-reference

ath:AT3G17611

hsa:84236

mmu:76867

pon:100172352

rno:316557

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.517

Rank 1 · LXL04_015316 · OH-1004

Golgi apparatus0.344

Rank 2 · LXL04_015316 · OH-1004

Cytoplasm0.108

Rank 3 · LXL04_015316 · OH-1004

Nucleus0.104

Rank 4 · LXL04_015316 · OH-1004

Cell membrane0.065

Rank 5 · LXL04_015316 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01694.29Rhomboid74-216 aa

PF00641.24Zn_ribbon_RanBP272-295 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015316	`PF01694.29`	Rhomboid	74	216	4.7e-22	79.4
LXL04_015316	`PF00641.24`	Zn_ribbon_RanBP	272	295	4.6e-06	26.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXW0`	Arabidopsis thaliana	Rhomboid-like protein 14, mitochondrial	60.429%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card