LXL04_015285 | RubberDandelionOmics

Gene overview

LXL04_015285

Reference: OH-1004 Chr: Chr03 Coordinates: 67521527-67523956 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1437 bp · LXL04_015285|LXL04_015285|OH1004|cDNA

ATGCATTTAAGCGAGAACGAGGGTATAGAGGGGAAGGCGTTCGTTGTTACAGGTGGATTGGGTTTTGTAGGTTCAGCACTGTGTTTGGAGCTGATTCGTAGGGGCGCGCGTCTTGTTCGAGCTTTTGATCTAAGATCAACTTCTCCTTGGTCCGATCATCTTCTCAAAAATGGTGTCCACTGTGTTAAAGGTGACATCACTAATAGAAAAGATGTGGAAAAGGCATTACGTGGAGTAGACTGTGTGTTCCACCTAGCTTC...

CDS

Download CDS FASTA

1437 bp · LXL04_015285|LXL04_015285|OH1004|CDS

ATGCATTTAAGCGAGAACGAGGGTATAGAGGGGAAGGCGTTCGTTGTTACAGGTGGATTGGGTTTTGTAGGTTCAGCACTGTGTTTGGAGCTGATTCGTAGGGGCGCGCGTCTTGTTCGAGCTTTTGATCTAAGATCAACTTCTCCTTGGTCCGATCATCTTCTCAAAAATGGTGTCCACTGTGTTAAAGGTGACATCACTAATAGAAAAGATGTGGAAAAGGCATTACGTGGAGTAGACTGTGTGTTCCACCTAGCTTC...

Protein

Download Protein FASTA

478 aa · LXL04_015285|LXL04_015285|OH1004|PROTEIN

MHLSENEGIEGKAFVVTGGLGFVGSALCLELIRRGARLVRAFDLRSTSPWSDHLLKNGVHCVKGDITNRKDVEKALRGVDCVFHLASFGMSGKEMLQYGRVDDININGTCHVLEACHEHNVKRLVYVSTSNVVFAGNEIVNGNERLPYLPLDNHVDPYSRSKSIAEQLVLKTNGRPSKGKNGECLYTCAIRPAAIYGPGEERHIPRIINLAKLGLLSFKIGNPNVKSDWVYIDNLVLALVLASMGLLDDIPGRGKQPIAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015285`
TK1151 ID	TkA02G348660
OH-1004 ID	LXL04_015285
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.700
Protein coverage (%)	TK1151 48.528 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_015285`
Location	Chr03:67521527-67523956 (-)
Description	Similar to sdr42e1: Short-chain dehydrogenase/reductase family 42E member 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015285` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006694 steroid biosynthetic process Biological Process GO:0016020 membrane Cellular Component GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function
KEGG gene cross-reference	dre:565964 hsa:93517 mcf:101925751 mmu:74032 xla:779408 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.420

Rank 1 · LXL04_015285 · OH-1004

Mitochondrion0.224

Rank 2 · LXL04_015285 · OH-1004

Cytoplasm0.151

Rank 3 · LXL04_015285 · OH-1004

Nucleus0.094

Rank 4 · LXL04_015285 · OH-1004

Golgi apparatus0.094

Rank 5 · LXL04_015285 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01073.263Beta_HSD15-292 aa

PF01370.28Epimerase15-242 aa

PF02719.22Polysacc_synt_215-133 aa

PF04321.24RmlD_sub_bind15-173 aa

PF16363.12GDP_Man_Dehyd16-241 aa

PF07993.19NAD_binding_416-175 aa

PF13460.13NAD_binding_1018-168 aa

PF14934.14TMEM254384-474 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015285	`PF01073.26`	3Beta_HSD	15	292	3.1e-83	279.8
LXL04_015285	`PF01370.28`	Epimerase	15	242	2.2e-36	126.2
LXL04_015285	`PF02719.22`	Polysacc_synt_2	15	133	6.5e-10	39.4
LXL04_015285	`PF04321.24`	RmlD_sub_bind	15	173	4.7e-09	36.4
LXL04_015285	`PF16363.12`	GDP_Man_Dehyd	16	241	2.2e-22	80.7
LXL04_015285	`PF07993.19`	NAD_binding_4	16	175	2.7e-11	43.8
LXL04_015285	`PF13460.13`	NAD_binding_10	18	168	8.7e-14	52.5
LXL04_015285	`PF14934.14`	TMEM254	384	474	4.5e-24	85.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card